Recombinant Haemophilus influenzae Biopolymer transport protein exbB (exbB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
exbB; HI_0253; Biopolymer transport protein ExbB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-150
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
exbB
Target Protein Sequence
MVQLFDFLQQYSDYFIIGLLLLMSIIMLAMVIERYLFLRKVSVAHYSTIHALDIDLNRNM TVISTIGANAPYVGLLGTVIGILLTFYQIGHGGGDIDPSVIMLHLSLALKATALGILVAI PSMVFYNGLGRKVEVNRLKWKVLSEQKDKE
Uniprot No.

Target Background

Function
This protein is involved in TonB-dependent, energy-dependent transport of various receptor-bound substrates. It protects ExbD from proteolytic degradation and functionally stabilizes TonB.
Database Links

KEGG: hin:HI0253

STRING: 71421.HI0253

Protein Families
ExbB/TolQ family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the ExbB protein in Haemophilus influenzae?

ExbB is a biopolymer transport protein in Haemophilus influenzae that functions as a TonB accessory protein during biopolymer transport across the bacterial membrane . The protein works in conjunction with ExbD to form a complex that energizes TonB-dependent transport processes. The deduced H. influenzae ExbB protein possesses approximately 27% amino-acid identity (56% relatedness) with the Escherichia coli ExbB protein, indicating evolutionary conservation of this transport mechanism across bacterial species .

How does the ExbB protein relate to bacterial pathogenesis in H. influenzae?

The ExbB protein plays an indirect role in H. influenzae pathogenesis by facilitating essential nutrient acquisition systems. H. influenzae causes various serious infections including meningitis, bacteremia, pneumonia, and septic arthritis . The bacterium's ability to cause disease depends partly on efficient nutrient acquisition, particularly iron, which is often mediated through TonB-dependent transport systems that require ExbB functionality. Research methodologies for studying this relationship typically involve:

  • Construction of exbB gene knockout mutants

  • Virulence assessment in appropriate animal models

  • Growth studies under iron-limited conditions

  • Comparative transcriptomics to measure expression during infection

What are the optimal methods for cloning and expressing recombinant H. influenzae ExbB?

The cloning and expression of recombinant H. influenzae ExbB require careful consideration of several methodological factors:

Recommended Cloning Procedure:

  • PCR amplification of the exbB gene with primers containing appropriate restriction sites

  • Ligation into an expression vector with an inducible promoter (such as pET or pBAD systems)

  • Transformation into an appropriate E. coli host strain, preferably one lacking endogenous exbB to avoid complementation issues

  • Verification through sequencing to confirm the absence of mutations

For expression, IPTG induction (0.5-1.0 mM) at mid-log phase (OD600 of 0.6-0.8) with growth at 30°C rather than 37°C often improves protein solubility. Expression in E. coli strains specifically designed for membrane protein expression (such as C41/C43 strains) may improve yields.

How should experimental designs for studying ExbB function be structured?

When designing experiments to study ExbB function, researchers should employ factorial design principles to systematically explore the protein's characteristics and interactions:

Key Experimental Design Elements:

  • Include appropriate positive and negative controls (such as E. coli ExbB or non-functional mutants)

  • Use a fractional factorial approach when screening multiple experimental conditions

  • Implement randomization to minimize bias and confounding variables

  • Consider split-plot designs when dealing with hard-to-change factors

Table 1: Recommended Experimental Design for ExbB Functional Studies

Design TypeApplicationAdvantagesConsiderations
Complete Randomized DesignInitial characterizationStatistically robustRequires larger sample sizes
Fractional FactorialMulti-factor screeningResource-efficientSome interactions confounded
Response SurfaceOptimization of expressionIdentifies optimal conditionsRequires sequential experimentation
Split-PlotMixed membrane/soluble studiesAccommodates technical constraintsComplex analysis required

What complementation assays best demonstrate ExbB functionality?

Functional complementation assays represent a powerful approach to demonstrate ExbB activity:

Methodological Protocol:

  • Transform an E. coli exbB/exbD mutant strain with a plasmid encoding H. influenzae exbB

  • Assess the restoration of TonB-dependent functions such as:

    • Siderophore utilization

    • Susceptibility to colicins or phages requiring TonB system

    • Vitamin B12 uptake

  • Compare growth rates under iron-limited conditions

  • Quantify the degree of complementation using standardized growth assays

It's important to note that H. influenzae exbB has been demonstrated to partially complement E. coli exbB/exbD mutations, suggesting functional conservation despite sequence divergence . The partial nature of this complementation provides researchers with an opportunity to investigate structural determinants of species-specific activity.

How can exploratory research approaches be applied to ExbB protein study?

Exploratory research methods are particularly valuable when investigating novel aspects of ExbB function:

Exploratory Research Framework:

  • Begin with open-ended research questions about ExbB structure-function relationships

  • Apply qualitative and quantitative techniques to investigate protein-protein interactions

  • Use iterative experimental design, modifying approaches based on preliminary results

  • Employ diverse methodologies to build a comprehensive understanding

Particularly effective exploratory approaches include:

  • Pull-down assays to identify novel interaction partners

  • Structural studies using various biophysical techniques

  • Phenotypic screening of random mutagenesis libraries

  • Comparative genomics across different Haemophilus species

How does the ExbB protein interact with the TonB-ExbD complex at the molecular level?

Understanding the molecular interactions within the TonB-ExbB-ExbD complex requires sophisticated experimental approaches:

Research Methodologies:

  • Site-directed mutagenesis of key residues based on sequence alignment with E. coli homologs

  • Cross-linking studies to identify interaction surfaces

  • Co-immunoprecipitation with tagged variants

  • Structural biology approaches (X-ray crystallography, cryo-EM, or NMR)

Current research suggests that ExbB forms a pentameric structure in the inner membrane, creating a channel that may facilitate proton translocation. This energy is then transduced to TonB via interactions with ExbD. Further investigation using advanced biophysical techniques is needed to elucidate the precise mechanism in H. influenzae specifically.

What analytical methods best resolve contradictory data in ExbB functional studies?

When confronted with contradictory results in ExbB research, a systematic analytical approach is essential:

Resolution Framework:

  • Evaluate experimental designs for potential confounding variables

  • Apply robust statistical methods appropriate for the specific data type

  • Consider hidden variables such as:

    • Strain background differences

    • Growth conditions

    • Protein expression levels

    • Membrane composition variations

  • Design controlled experiments specifically to address the contradiction

Particularly useful statistical approaches include:

  • ANOVA with appropriate post-hoc tests for comparing multiple conditions

  • Regression analysis to identify relationship patterns

  • Principal component analysis to identify key variables driving differences

How can integrative approaches advance our understanding of ExbB function?

Future ExbB research will benefit from integrating multiple experimental approaches:

Integrative Research Strategies:

  • Combine structural studies with functional assays

  • Integrate genomics, transcriptomics, and proteomics data

  • Apply systems biology approaches to place ExbB function in broader cellular context

  • Develop computational models of the TonB-ExbB-ExbD energy transduction system

Such integrative approaches are particularly important given that ExbB functions as part of a complex with multiple proteins and is embedded within larger transport networks within the bacterial cell.

What emerging technologies show promise for ExbB research?

Several cutting-edge technologies offer new opportunities for studying ExbB:

Emerging Methodologies:

  • Cryo-electron tomography for visualizing membrane protein complexes in situ

  • Single-molecule tracking to follow ExbB dynamics in live cells

  • CRISPR-based approaches for precise genome editing in H. influenzae

  • Nanodiscs and synthetic membrane systems for controlled functional studies

These technologies can help overcome traditional challenges in membrane protein research, providing unprecedented insights into ExbB structure and function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.