Recombinant Haemophilus influenzae CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (pgsA)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Biological Role

PgsA is a membrane-associated enzyme essential for synthesizing phosphatidylglycerol (PG) and cardiolipin, which are vital for bacterial membrane integrity . The reaction it catalyzes is:

CDP-diacylglycerol + sn-glycerol-3-phosphateCMP + 3-(3-sn-phosphatidyl)-sn-glycerol 1-phosphate\text{CDP-diacylglycerol + sn-glycerol-3-phosphate} \rightleftharpoons \text{CMP + 3-(3-sn-phosphatidyl)-sn-glycerol 1-phosphate}

This step is a regulatory checkpoint in lipid metabolism, influencing membrane fluidity and antibiotic resistance .

Research Applications

  • Antibiotic Development: PgsA is a target for novel antimicrobials due to its role in lipid biosynthesis and absence in humans .

  • Enzymatic Assays: Recombinant PgsA is used to study kinetics and inhibition in vitro .

  • Structural Studies: Despite challenges in membrane protein crystallization, homolog structures guide mutagenesis studies to probe catalytic residues .

Functional Mutations and Resistance

In pathogenic bacteria like H. influenzae, mutations in lipid biosynthesis enzymes (e.g., altered penicillin-binding proteins) contribute to β-lactam resistance . While direct links between PgsA mutations and resistance in H. influenzae are not yet documented, structural parallels in S. aureus suggest potential mechanisms .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own adjustments.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize development of the specified tag.
Synonyms
pgsA; HI_0123; CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase; Phosphatidylglycerophosphate synthase; PGP synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
pgsA
Target Protein Sequence
MKFNIPIFLTIFRVILIPFFVIAFYLPIESSPFITTLIFFIAGVTDWLDGYLARKWKQTT RFGAFLDPVADKVMVVAALVLIVEHQHTFWITIPAIIMISREIIISALREWMAELGERSK IAVSWWGKWKTTAQMLALGGLLWRYNNYMEIAAIILLYIAAILTIWSMIQYLQVAKGSLL DNIQL
Uniprot No.

Target Background

Function
This protein catalyzes the committed step in the synthesis of acidic phospholipids.
Database Links

KEGG: hin:HI0123

STRING: 71421.HI0123

Protein Families
CDP-alcohol phosphatidyltransferase class-I family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (pgsA) and what is its primary function?

CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase, commonly known as PgsA, is a membrane-embedded enzyme that catalyzes the primary reaction in phosphatidylglycerol biosynthesis. Specifically, it transfers a phosphatidyl group from cytidine diphosphate-diacylglycerol (CDP-DAG) to glycerol-3-phosphate, forming phosphatidylglycerol phosphate (PGP) . This enzyme belongs to the CDP-OH_P_transf family and plays an essential role in bacterial membrane phospholipid composition.

The primary function of PgsA is to catalyze the synthesis of PGP, which is subsequently dephosphorylated to form phosphatidylglycerol (PG). PG is a major phospholipid component in bacterial membranes and serves as a precursor for cardiolipin synthesis. Genetic studies have shown that inactivation of pgsA leads to drastic reduction of PG, cardiolipin (CL), and PG derivatives in bacterial membranes, which are essential for cell growth and viability . These phospholipids are critical for maintaining membrane integrity, supporting membrane protein function, and facilitating bacterial cell division processes.

In Haemophilus influenzae, as in other bacteria, the pgsA enzyme is crucial for proper membrane composition, which affects bacterial survival, pathogenicity, and response to environmental stresses including antibiotics.

How is the pgsA gene annotated in bacterial genomes?

The pgsA gene is found across diverse bacterial species with some variation in naming conventions and genomic organization. In Mycobacterium tuberculosis, for example, the gene is annotated as Rv2746c (pgsA3) and encodes a CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) . The genomic annotation provides several key pieces of information:

FeatureData for M. tuberculosis pgsA3
Locus tagRv2746c
ProductCDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
EC Number2.7.8.5
Start Position3058602
End Position3059231
StrandNegative (-)
Length630 bp
Amino Acid Length209 aa
Transcription FactorFALSE

Additionally, in M. tuberculosis, pgsA3 is predicted to be co-regulated in specific gene modules (bicluster_0053 with residual 0.49 and bicluster_0112 with residual 0.53), suggesting integration into broader transcriptional networks . This co-regulation is potentially mediated by distinct cis-regulatory motifs with varying significance (e-values ranging from 0.70 to 1,200.00).

Across different bacterial species, the gene may have slight variations in name and organization while maintaining its essential function in phospholipid biosynthesis.

What is the structural organization of bacterial PgsA proteins?

While the specific crystal structure of PgsA from Haemophilus influenzae has not been fully determined based on the provided information, structural insights can be derived from studies of homologous enzymes, particularly from Staphylococcus aureus (SaPgsA) . The structural organization of bacterial PgsA proteins typically includes:

  • Multiple transmembrane (TM) domains that anchor the protein within the bacterial cell membrane

  • A trifurcated amphipathic cavity that houses the active site

  • Distinct binding pockets for the hydrophilic head groups of substrates (CDP-DAG) and products (PGP)

  • An elongated membrane-exposed surface groove that accommodates the fatty acyl chains of lipid substrates

  • A lateral portal for lipid entry and release during the catalytic cycle

The transmembrane helices of PgsA are positioned to create a concave surface underneath the membrane, which may induce local membrane deformation . In SaPgsA, extracellular regions include a long TM1-2 loop and the TM5-6 loop with a short four-residue α-helix near the membrane surface, while a shorter TM3-4 loop is located below the membrane surface .

On the intracellular side, all transmembrane segments extend out of the membrane surface and protrude into the cytoplasm . This arrangement differs from other CDP-OH_P_transf family members, such as AF2299 and PIPS from Mycobacterium kansasii, where TM5 is completely buried in the membrane .

This structural organization facilitates the enzyme's function in the membrane environment while providing the necessary conformational flexibility for substrate binding and catalysis.

What biochemical reactions does pgsA catalyze?

PgsA catalyzes a specific phosphotransferase reaction in the phospholipid biosynthesis pathway. The primary reaction catalyzed by PgsA can be represented as:

CDP-diacylglycerol + glycerol-3-phosphate → phosphatidylglycerol phosphate (PGP) + CMP

This reaction represents a critical branch point in phospholipid biosynthesis and proceeds through the following mechanistic steps:

  • Binding of CDP-diacylglycerol within the active site cavity

  • Binding of glycerol-3-phosphate in a specific pocket of the enzyme

  • Nucleophilic attack by the 3-hydroxyl group of glycerol-3-phosphate on the phosphate of CDP-DAG

  • Formation of a phosphodiester bond creating PGP

  • Release of cytidine monophosphate (CMP) as a byproduct

  • Conformational changes facilitating product (PGP) release

This enzymatic reaction is essential for membrane phospholipid homeostasis and is particularly important in bacteria, where PG and CL are major membrane components affecting cell division, antibiotic susceptibility, and numerous other cellular processes.

Why is pgsA important in bacterial physiology?

PgsA plays critical roles in bacterial physiology that extend beyond its enzymatic function in phospholipid biosynthesis. Its importance is evident across multiple aspects of bacterial biology:

  • Membrane Structure and Integrity: By catalyzing the synthesis of precursors for phosphatidylglycerol (PG) and cardiolipin (CL), pgsA directly influences membrane composition, fluidity, and permeability. Inactivation of pgsA leads to drastic reduction of these essential phospholipids in bacterial membranes .

  • Antibiotic Resistance: PgsA has been frequently associated with daptomycin resistance in pathogenic bacteria including Staphylococcus aureus, Bacillus subtilis, Corynebacterium striatum, Staphylococcus capitis, and Streptococcus oralis . Mutations in pgsA can alter membrane phospholipid composition, reducing the binding or effectiveness of antibiotics that target bacterial membranes.

  • Potential Antibacterial Target: SaPgsA has recently been identified as a potential antibacterial target to eradicate methicillin-resistant S. aureus (MRSA) persisters . Its essential role makes it an attractive target for developing novel antimicrobial agents.

  • Photosynthetic Function in Cyanobacteria: In cyanobacteria, dysfunctional PgsA impairs the assembly, oligomerization, and function of both photosystem I (PSI) and photosystem II (PSII), highlighting its importance in photosynthetic organisms .

  • Evolutionary Significance: Mitochondrial cardiolipin synthases might have evolved from prokaryotic PgsA through neofunctionalization of the bacterial ancestor, suggesting an important evolutionary role .

  • Integration with Metabolic Networks: In Mycobacterium tuberculosis, pgsA3 (Rv2746c) is predicted to be co-regulated with other genes in specific modules, indicating integration into broader metabolic and regulatory networks .

These diverse roles underscore why pgsA is an important subject of study in microbiology, particularly in the context of antibiotic resistance and bacterial pathogenesis.

What methods are most effective for expressing and purifying recombinant pgsA from Haemophilus influenzae?

Expressing and purifying recombinant membrane proteins like pgsA from Haemophilus influenzae presents significant challenges due to their hydrophobic nature and requirement for a lipid environment. Based on successful approaches with similar membrane proteins, including another Haemophilus influenzae membrane-associated protein, the following methodological strategy is recommended:

Vector Design and Expression System:

  • Replace the N-terminal lipid modification signal sequence with a protein secretion signal without lipid modification to improve purification yields, as demonstrated with the bacterial lipoprotein e (P4) from Haemophilus influenzae .

  • Place expression under control of a T7-inducible promoter system for controlled protein production .

  • Incorporate a purification tag (His6, GST, or MBP) to facilitate downstream purification steps.

  • Use E. coli BL21(DE3) or specialized membrane protein expression strains like C41/C43(DE3).

Optimized Expression Protocol:

  • Culture at lower temperatures (16-25°C) after induction to slow protein production and facilitate proper folding.

  • Use moderate IPTG concentrations (0.1-0.5 mM) for controlled induction .

  • Extend expression time to 16-24 hours at the lower temperature.

  • Supplement media with glycerol (5-10%) to stabilize membrane proteins.

Membrane Protein Extraction:

  • Harvest cells and disrupt by gentle lysis methods, potentially combining enzymatic treatment with mechanical disruption.

  • Isolate membrane fractions by differential centrifugation.

  • Screen detergents systematically (DDM, LDAO, OG, Triton X-100) to identify optimal solubilization conditions.

  • Solubilize the target protein under conditions that maintain its native conformation and activity.

Purification Strategy:

  • Utilize affinity chromatography based on the incorporated tag (IMAC for His-tagged proteins) .

  • Perform size exclusion chromatography to remove aggregates and improve homogeneity .

  • Consider ion exchange chromatography as a polishing step if needed.

  • Maintain appropriate detergent concentrations throughout purification to prevent aggregation.

Activity and Quality Assessment:

  • Develop a functional assay to verify enzymatic activity of the purified protein.

  • Confirm protein identity by mass spectrometry and/or western blotting .

  • Assess purity by SDS-PAGE and protein staining methods .

  • Evaluate protein stability under various buffer conditions by thermal shift assays.

This approach has been successful with the Haemophilus influenzae lipoprotein e (P4), where high levels of phosphomonoesterase activity were achieved after IPTG induction and the protein was purified to apparent homogeneity after two chromatography steps . The recombinant protein maintained characteristics similar to the wild-type protein in terms of molecular weight, primary structure, substrate specificity, pH optimum, and inhibitor sensitivity profiles .

How do mutations in pgsA contribute to antibiotic resistance mechanisms?

Mutations in pgsA have been increasingly recognized as important contributors to antibiotic resistance, particularly against daptomycin, which is used for treating serious infections caused by methicillin-resistant Staphylococcus aureus (MRSA), vancomycin-resistant Enterococci (VRE), and other Gram-positive pathogens . The mechanisms through which pgsA mutations confer resistance are complex and multifaceted:

Altered Membrane Phospholipid Composition:
Mutations in pgsA that reduce enzyme activity lead to changes in membrane phospholipid composition, particularly decreasing phosphatidylglycerol (PG) and cardiolipin (CL) content . Since daptomycin requires interaction with PG for antimicrobial activity, reduced PG levels diminish the antibiotic's binding sites and effectiveness.

Structural Basis of Resistance:
Crystal structures of SaPgsA have revealed that daptomycin resistance-related mutations mostly cluster around the active site of the enzyme, causing reduction in enzymatic activity . This clustering suggests specific structural mechanisms underlying resistance:

  • Mutations may directly affect substrate binding affinity

  • Alterations could disrupt the catalytic mechanism

  • Conformational changes might affect product release

  • Membrane interaction could be modified by certain mutations

Documented Resistance Associations:
Accumulating evidence shows that mutations in pgsA correlate with daptomycin resistance in several Gram-positive bacteria including:

  • Staphylococcus aureus

  • Bacillus subtilis

  • Corynebacterium striatum

  • Staphylococcus capitis

  • Streptococcus oralis

Broader Resistance Implications:
Beyond daptomycin, pgsA mutations may contribute to resistance against other membrane-targeting antimicrobials through:

  • General alterations in membrane charge and permeability

  • Changes in membrane fluidity affecting drug penetration

  • Modifications to membrane protein function involved in antibiotic uptake or efflux

These findings highlight the importance of understanding the structure-function relationship of pgsA for addressing antibiotic resistance and potentially developing new antimicrobial strategies targeting this enzyme or compensating for its mutation-induced effects.

What are the latest structural insights into pgsA's catalytic mechanism?

Recent structural studies, particularly of SaPgsA from Staphylococcus aureus, have provided significant breakthroughs in understanding the catalytic mechanism of phosphatidylglycerol phosphate synthase. These structures, captured at two distinct states of the catalytic process, reveal molecular details essential for enzyme function and provide a framework for inhibitor development:

Structural Organization of the Active Site:
The crystal structures of SaPgsA have been resolved at 2.5 Å (with PGP bound) and 3.0 Å (with CDP-DAG bound), revealing that the active site is located within a trifurcated amphipathic cavity . This cavity accommodates both substrate and product in distinct binding modes, with the hydrophilic head groups of CDP-DAG and PGP occupying different pockets and inducing local conformational changes .

Lipid Entry and Binding Mechanism:
An elongated membrane-exposed surface groove has been identified that accommodates the fatty acyl chains of CDP-DAG/PGP and opens a lateral portal for lipid entry and release . This architecture allows the enzyme to access lipid substrates directly from the membrane environment, an essential feature for integral membrane enzymes involved in phospholipid biosynthesis.

Transmembrane Domain Arrangement:
The transmembrane helices of PgsA are positioned to create a concave surface underneath the membrane, which may induce local membrane deformation to facilitate substrate extraction from the bilayer . Two extracellular regions (the long TM1-2 loop and the TM5-6 loop with a short four-residue α-helix) are positioned near the membrane surface, while a shorter TM3-4 loop is located below the membrane surface .

Proposed Catalytic Mechanism:
Based on the structural data, the catalytic mechanism likely proceeds through:

  • Lateral entry of CDP-DAG from the membrane into the active site

  • Binding of glycerol-3-phosphate in its specific pocket

  • Nucleophilic attack facilitated by precisely positioned catalytic residues

  • Formation of PGP and release of CMP

  • Conformational changes facilitating product release back to the membrane

Structure-Resistance Relationships:
Remarkably, the daptomycin resistance-related mutations mostly cluster around the active site, causing reduction of enzymatic activity . This clustering provides a structural explanation for how these mutations affect enzyme function and consequently contribute to antibiotic resistance.

These structural insights provide detailed mechanistic understanding of PgsA function and establish a foundation for structure-based drug design targeting this essential bacterial enzyme.

How can enzymatic activity of recombinant pgsA be reliably measured?

Radiometric Assays:

  • Utilize radiolabeled substrates (³²P-labeled CDP-DAG or glycerol-3-phosphate)

  • Measure incorporation of radioactivity into phosphatidylglycerol phosphate (PGP)

  • Separate reaction products by thin-layer chromatography (TLC)

  • Quantify incorporated radioactivity by scintillation counting

Coupled Enzymatic Assays:

  • Monitor CMP production by coupling to CMP kinase and pyruvate kinase/lactate dehydrogenase

  • Measure NADH oxidation spectrophotometrically to indirectly quantify pgsA activity

  • Include appropriate controls to account for background activity

Mass Spectrometry-Based Approaches:

  • Direct detection and quantification of PGP production using LC-MS/MS

  • Monitor substrate depletion and product formation simultaneously

  • High specificity for distinguishing between lipid species with similar properties

Fluorescence-Based Methods:

  • Develop fluorescently labeled substrate analogs

  • Monitor fluorescence changes upon substrate conversion

  • Potential for high-throughput screening applications

Reconstitution Systems:
Different membrane mimetic systems can be employed to maintain enzyme activity:

  • Detergent micelles with carefully optimized detergent type and concentration

  • Proteoliposomes with defined lipid composition

  • Nanodiscs providing a native-like membrane environment

Optimization Parameters for Activity Assays:

ParameterOptimization RangeConsiderations
pH6.5-8.0Buffer composition affects stability
Temperature25-37°CBalance activity vs. stability
Divalent Cations5-10 mM Mg²⁺Essential cofactor for activity
Detergent0.01-0.1%Type and concentration critical
Glycerol5-20%Stabilizes membrane proteins
Substrate Concentrations10-100 μMMay require optimization for Km determination

For validation of recombinant protein activity, comparison with native enzyme characteristics is essential. With Haemophilus influenzae recombinant proteins, it has been demonstrated that properly designed recombinant versions can maintain characteristics similar to wild-type proteins in terms of substrate specificity, pH optimum, and sensitivity or resistance to various inhibitors .

These assays provide complementary information about enzyme function and can be selected based on available equipment, substrate accessibility, and specific experimental objectives.

What is the relationship between pgsA function and bacterial membrane homeostasis?

PgsA plays a central role in bacterial membrane homeostasis through its essential function in phospholipid biosynthesis, with far-reaching implications for membrane structure, function, and adaptation to environmental stresses:

Phospholipid Composition Regulation:
PgsA catalyzes the synthesis of phosphatidylglycerol phosphate (PGP), which is subsequently dephosphorylated to form phosphatidylglycerol (PG). PG serves as both a major membrane phospholipid and a precursor for cardiolipin (CL) synthesis . Inactivation of pgsA leads to drastic reduction of PG, CL, and PG derivatives in bacterial membranes, which are essential for cell growth and viability .

Membrane Physical Properties:
The phospholipids produced through the pgsA pathway contribute to:

  • Membrane fluidity and permeability

  • Surface charge distribution (PG provides negative charge)

  • Membrane curvature (particularly influenced by cardiolipin)

  • Lateral organization and domain formation

Protein-Lipid Interactions:
PG and CL interact specifically with numerous membrane proteins, affecting their:

  • Folding and structural integrity

  • Enzymatic activity

  • Complex assembly and stabilization

This is particularly evident in cyanobacteria, where dysfunctional PgsA impairs the assembly, oligomerization, and function of both photosystem I (PSI) and photosystem II (PSII) .

Stress Response and Adaptation:
PgsA activity may be modulated in response to various stressors, allowing bacteria to adapt their membrane composition to:

  • Temperature fluctuations (altering membrane fluidity)

  • Osmotic stress (modifying membrane permeability)

  • pH changes (adjusting membrane charge distribution)

  • Antibiotic exposure (altering drug binding sites)

Evolutionary Perspective:
The importance of pgsA in membrane homeostasis is underscored by evolutionary conservation, with mitochondrial cardiolipin synthases potentially evolving from prokaryotic PgsA through neofunctionalization of the bacterial ancestor . This suggests an ancient and fundamental role in cellular membrane organization.

Clinical Relevance:
Disruptions in pgsA function can have significant clinical implications:

  • Mutations associated with daptomycin resistance in multiple pathogenic bacteria

  • Potential target for novel antimicrobial development

  • PGP synthase gene expression regulation by factors affecting mitochondrial development in eukaryotes

Understanding this central role of pgsA in membrane homeostasis provides insights into bacterial physiology and potential approaches for therapeutic intervention.

What strategies can be employed for rational design of inhibitors targeting pgsA?

The structural and functional insights into pgsA provide multiple avenues for rational design of inhibitors with potential antimicrobial applications. Based on current understanding of the enzyme, several strategic approaches can be considered:

Structure-Based Design Targeting Active Site:
The crystal structures of SaPgsA with CDP-DAG and PGP bound to the active site provide templates for structure-based drug design . Potential approaches include:

  • Competitive inhibitors mimicking the transition state of the catalytic reaction

  • Development of substrate analogs with modifications preventing catalysis

  • Design of compounds that occupy both substrate and product binding pockets

  • Targeting the specific residues involved in catalysis

Allosteric Inhibition Strategies:

  • Identification of allosteric binding sites that affect enzyme conformation

  • Compounds that stabilize inactive conformations of the enzyme

  • Molecules that disrupt protein dynamics essential for catalysis

Membrane Interface Targeting:
The elongated membrane-exposed surface groove and lateral portal for lipid entry/release represent unique structural features that could be targeted :

  • Compounds that block the lateral portal for substrate entry

  • Molecules that disrupt the membrane-enzyme interface

  • Inhibitors that alter local membrane curvature around the enzyme

Rational Modification of Known Compounds:
Building on existing phospholipid biosynthesis inhibitors by:

  • Adding membrane-targeting moieties to improve localization

  • Incorporating structural elements that enhance specificity for pgsA

  • Developing prodrug approaches for improved bacterial penetration

Computational Design Strategy:

ApproachMethodologyPotential Advantages
Virtual ScreeningDocking libraries against known binding sitesRapid identification of leads
Molecular DynamicsSimulation of protein-inhibitor interactionsUnderstanding binding dynamics
Fragment-BasedScreening small fragments and growing/linkingBuilding high-affinity binders
Machine LearningPredictive models based on known inhibitorsNovel chemical scaffolds

Targeting Resistance-Associated Regions:
The clustering of daptomycin resistance-related mutations around the active site provides insight into functionally critical regions . Designing inhibitors that specifically interact with these regions might:

  • Create higher barriers to resistance development

  • Restore sensitivity to existing antibiotics

  • Provide effectiveness against already resistant strains

Given that SaPgsA has been identified as a potential antibacterial target to eradicate methicillin-resistant S. aureus (MRSA) persisters , these rational design approaches could yield valuable new antimicrobial agents for addressing the growing challenge of antibiotic resistance.

How does pgsA compare structurally and functionally across different bacterial species?

The structural and functional characteristics of pgsA exhibit both conservation and variation across bacterial species, reflecting evolutionary adaptation to different membrane environments and metabolic requirements:

Sequence and Size Variation:
Across bacterial species, pgsA shows variable protein length and sequence identity while maintaining core functional domains:

  • In Mycobacterium tuberculosis, pgsA3 (Rv2746c) is 209 amino acids in length

  • Sequence conservation is typically higher in the catalytic core than in peripheral regions

  • Transmembrane domains show greater variability reflecting adaptation to different membrane compositions

Structural Conservation and Differences:
While the basic architectural features are conserved, notable differences exist:

  • Number and arrangement of transmembrane helices may vary

  • Surface-exposed loops show significant variation in length and composition

  • The positioning of TM5 in SaPgsA (extending out of the membrane) differs from other CDP-OH_P_transferase family members like AF2299 and PIPS from Mycobacterium kansasii (where TM5 is completely buried in the membrane)

Functional Adaptation:
Functional characteristics may vary between species due to:

  • Differences in native substrate preferences or kinetic parameters

  • Varying regulatory mechanisms controlling enzyme expression and activity

  • Integration into species-specific metabolic networks

This is supported by the observation that in Mycobacterium tuberculosis, pgsA3 is predicted to be co-regulated in modules with distinct regulatory motifs , suggesting species-specific transcriptional regulation.

Pathogenicity and Virulence Associations:
The relationship between pgsA and pathogenicity varies across species:

  • In Staphylococcus aureus, pgsA mutations are associated with daptomycin resistance

  • In Haemophilus influenzae, recombinant protein technologies have been employed to study membrane-associated proteins, though specific pgsA virulence associations are less characterized

  • Multiple Gram-positive pathogens show correlations between pgsA mutations and antibiotic resistance

Evolutionary Relationships:
Evolutionary analysis suggests:

  • Conservation of core catalytic function across diverse bacterial phyla

  • Potential ancestral relationship to eukaryotic phospholipid biosynthetic enzymes

  • Evidence that mitochondrial cardiolipin synthases might have evolved from prokaryotic PgsA through neofunctionalization

Understanding these cross-species variations is important for developing targeted antimicrobials with appropriate spectrum of activity and for predicting potential resistance mechanisms in different pathogens.

What are the implications of pgsA research for development of novel antimicrobial strategies?

Research on pgsA has significant implications for developing novel antimicrobial strategies, offering multiple avenues to address the growing challenge of antibiotic resistance:

Direct Targeting of PgsA:
Recent structural and functional characterization of PgsA provides a foundation for developing specific inhibitors . The high-resolution structures of SaPgsA with bound substrate and product offer templates for structure-based drug design targeting:

  • The trifurcated amphipathic cavity containing the active site

  • The elongated membrane-exposed surface groove that accommodates fatty acyl chains

  • The lateral portal for lipid entry/release

Addressing Daptomycin Resistance:
Understanding how pgsA mutations contribute to daptomycin resistance provides opportunities for:

  • Developing combination therapies that overcome resistance mechanisms

  • Creating modified lipopeptide antibiotics that retain activity against resistant strains

  • Designing adjuvants that restore daptomycin sensitivity in resistant bacteria

This is particularly important given that pgsA mutations correlate with daptomycin resistance in several Gram-positive bacteria including Staphylococcus aureus, Bacillus subtilis, Corynebacterium striatum, Staphylococcus capitis, and Streptococcus oralis .

Targeting Persistent Infections:
SaPgsA has been identified as a potential antibacterial target to eradicate methicillin-resistant S. aureus (MRSA) persisters , suggesting applications in:

  • Treating chronic or recurrent infections resistant to conventional antibiotics

  • Eliminating persister cells that contribute to treatment failure

  • Developing anti-biofilm strategies targeting metabolically diverse bacterial populations

Membrane-Focused Antimicrobial Approaches:
Insights into pgsA's role in membrane homeostasis suggest broader strategies:

  • Combining pgsA inhibitors with other membrane-targeting antibiotics for synergistic effects

  • Developing compounds that exploit altered membrane composition in pgsA-mutant strains

  • Creating targeted delivery systems that interact with specific membrane components

Exploiting Species-Specific Differences:
Comparative analysis of pgsA across bacterial species reveals differences that could be exploited for:

  • Narrow-spectrum antibiotics targeting specific pathogens

  • Selective inhibitors based on structural differences in the enzyme active site

  • Species-specific delivery strategies leveraging differences in membrane composition

Diagnostic Applications:
Understanding pgsA mutations and their relationship to resistance provides opportunities for:

  • Developing diagnostic tests to predict antibiotic susceptibility

  • Monitoring the emergence of resistance in clinical settings

  • Guiding personalized antimicrobial therapy based on bacterial genotype

These research directions highlight the potential of pgsA as a focal point for developing novel antimicrobial strategies that address current challenges in treating resistant bacterial infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.