Recombinant Haemophilus influenzae Cell division protein FtsX homolog (ftsX)

Shipped with Ice Packs

In Stock

Cat. No.

BT2057957

Source

in vitro E.coli expression system

Synonyms

ftsX; HI_0770; Cell division protein FtsX

Quick Inquiry

Description

Role in Bacterial Physiology and Antibiotic Resistance

Cell Division Mechanism:

FtsX interacts with penicillin-binding proteins (PBPs), such as PBP3A/B, which are targets for β-lactam antibiotics . Mutations in related genes (e.g., ftsI) alter PBP3 structure, reducing β-lactam affinity and conferring resistance .

Resistance-Linked Polymorphisms:

While ftsX itself is not directly mutated in resistant strains, its interaction with ftsI (encoding PBP3) is critical. For example:
- Substitutions in ftsI (e.g., Arg-517→His, Asn-526→Lys) correlate with β-lactam resistance in H. influenzae .
- Non-β-lactamase-mediated resistance (BLNAR) strains show ftsI mutations classified into Groups I–III .

Applications in Research and Development

Vaccine Development:

Recombinant FtsX is used as an antigen in vaccine candidates against H. influenzae, particularly non-typeable strains (NTHi) .
Example: Creative Biolabs offers FtsX (aa 1–310) for immunological studies .

Antibiotic Resistance Studies:

Used to model cell division machinery and test inhibitors targeting ABC transporters .
Comparative studies with β-lactam-resistant H. influenzae strains reveal mechanistic insights into PBP3-FtsX interactions .

Production and Quality Control

Expression and Purification:

Yield: High levels achieved via T7-promoter systems (e.g., in E. coli) .
Purification Methods:
1. Chromatography (e.g., gel filtration, ion exchange) .
2. SDS-PAGE validation (≥85% purity) .

Stability:

Storage at –80°C in glycerol-containing buffers preserves activity .

Key Research Findings

Genetic Diversity:

PFGE analysis of H. influenzae clinical isolates shows 19 distinct pulsotypes, with biotypes I and IV predominating in susceptible and resistant strains, respectively .

Physicochemical Properties:

Recombinant FtsX retains wild-type enzymatic activity despite modifications (e.g., removal of lipid anchors) .

Challenges and Future Directions

Functional Redundancy: FtsX homologs in other pathogens (e.g., Mycobacterium, Neisseria) complicate targeted drug design .
Structural Studies: Cryo-EM or X-ray crystallography of FtsX-PBP3 complexes could unveil new antibiotic targets .

Product Specs

Form

Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request accordingly.

Lead Time

Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.

Notes

Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.

Reconstitution

We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can serve as a reference.

Shelf Life

Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.

Storage Condition

Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.

Tag Info

The tag type will be determined during the manufacturing process.

The tag type will be determined during the production process. If you have specific tag type requirements, please communicate them to us, and we will prioritize developing the specified tag.

Synonyms

ftsX; HI_0770; Cell division protein FtsX

Buffer Before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Datasheet

Please contact us to get it.

Expression Region

1-310

Protein Length

full length protein

Species

Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

Target Names

ftsX

Target Protein Sequence

MSRSTDASVFVQTAYTLRAVWADLWQRKFGTLLTILVIAVSLTIPTVSYLMWKNLHLATT QFYPESELTIYLHKNLSEENANLVVEKIRQQKGVESLNYVSRQESLKEFKSWSGFGEELE ILDDNPLPAVVIVKPTSEFNVSEKRDELRTNLNKIKGVQEVRLDNDWMEKLTALSWLIAH VAIFCTVLMTIAVFLVIGNSIRSDVYSSRSSIDVMKLLGATDQFILRPYLYTGMIYALLG GLVAAIFSSFIISYFTSAVKYVTDIFAVQFSLNGLGVGEFVFLLVCCLIMGYVGAWIAAT RHIAMMERKE

Uniprot No.

P44872

Target Background

Function

This protein is part of the ABC transporter FtsEX, which plays a crucial role in cellular division.

Database Links

KEGG: hin:HI0770

STRING: 71421.HI0770

Protein Families

ABC-4 integral membrane protein family, FtsX subfamily

Subcellular Location

Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected

Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Name*

Email*

Phone

Country

Source

Quantity&Size*

Product Name

Message

Recombinant Haemophilus influenzae Cell division protein FtsX homolog (ftsX)

Description

Role in Bacterial Physiology and Antibiotic Resistance

Cell Division Mechanism:

Resistance-Linked Polymorphisms:

Applications in Research and Development

Vaccine Development:

Antibiotic Resistance Studies:

Production and Quality Control

Expression and Purification:

Stability:

Key Research Findings

Genetic Diversity:

Physicochemical Properties:

Challenges and Future Directions

Product Specs

Target Background

Quick Inquiry

Category

Service