Recombinant Haemophilus influenzae Dipeptide transport system permease protein dppC (dppC)

Shipped with Ice Packs
In Stock

Description

Introduction to Haemophilus influenzae dppC Protein

Haemophilus influenzae is a fastidious facultatively anaerobic Gram-negative bacterium responsible for numerous human infections including otitis media, meningitis, epiglottitis, and pneumonia . A fundamental characteristic of this pathogen is its absolute requirement for exogenous porphyrin sources, as it lacks the complete enzymatic pathway for protoporphyrin IX (PPIX) biosynthesis, the immediate precursor of heme . This nutritional requirement has driven the evolution of sophisticated transport systems to acquire essential nutrients from the host environment.

The dppC protein constitutes an integral component of the dppBCDF gene cluster in H. influenzae, which encodes a specialized ATP-binding cassette (ABC) transport system . Located at the HI1184-1187 locus in the H. influenzae strain Rd KW20 genome, this transport complex plays a pivotal role in the organism's ability to import critical nutrients across the periplasmic space . The dppBCDF cluster is transcribed as a polycistronic message, with bioinformatic analyses indicating the presence of a promoter upstream of dppB .

Role in Heme Acquisition

H. influenzae has an absolute growth requirement for an exogenous source of protoporphyrin IX (PPIX) or heme, lacking all enzymes necessary for porphyrin ring biosynthesis . To overcome this limitation, the organism has developed sophisticated nutrient acquisition systems, with the dppBCDF transport complex playing a significant role in heme utilization.

Research has established that mutations in the dppC gene significantly impair the organism's ability to utilize various heme sources. Growth curve analyses comparing a dppC insertional mutant (strain TMV1262) with the wildtype strain revealed substantial growth deficits in the mutant when provided with free heme at concentrations of 10, 2, and 1 μg/ml . Statistical analysis demonstrated highly significant differences (P < 0.0001) when comparing growth patterns over the entire growth period .

The impact of dppC mutation extends beyond the utilization of free heme to affect the processing of various proteinaceous heme sources, as outlined in Table 1.

Table 1: Growth Impairment of dppC Mutant with Various Heme Sources

Heme SourceConcentrationGrowth Impact in dppC MutantStatistical Significance
Free heme10, 2, 1 μg/mlSignificantly reducedP < 0.0001
Heme-human serum albumin200, 100 ng/mlSignificantly reducedP < 0.0001
HemoglobinMultiple concentrationsSignificantly reducedP < 0.0001
Hemoglobin-haptoglobin complexesMultiple concentrationsSignificantly reducedP < 0.0001

Importantly, complementation studies using an intact dppCBDF gene cluster provided in trans successfully corrected the growth deficits observed in the dppC mutant strain, confirming the direct involvement of this gene cluster in heme acquisition .

Role in Glutathione Transport

Beyond heme transport, recent research has uncovered a crucial role for the dppBCDF transport system in glutathione acquisition. Glutathione (GSH), an essential tripeptide (γ-glutamyl-cysteinyl-glycine) that reaches millimolar concentrations within cells, mediates numerous cellular functions .

H. influenzae is a glutathione auxotroph, requiring exogenous sources of this vital compound. Studies have demonstrated that the ATP-binding cassette (ABC)-like dipeptide transporter DppBCDF mediates the import of glutathione in H. influenzae . This transport process is facilitated by a dedicated periplasmic-binding protein (PBP) that primes the system for efficient glutathione transport .

The periplasmic lipoprotein HbpA, previously implicated primarily in heme acquisition, has been identified as the cognate periplasmic-binding protein that specifically binds both reduced (GSH) and oxidized (GSSG) forms of glutathione with physiologically relevant affinity . This multifunctional capacity of the dppBCDF system, together with HbpA, underscores the sophisticated nutrient acquisition strategies evolved by H. influenzae to ensure survival in the host environment.

Production of Recombinant dppC

The production of recombinant H. influenzae dppC protein typically employs Escherichia coli expression systems. Commercial recombinant versions of the full-length dppC protein (comprising amino acids 1-295) are commonly fused to an N-terminal histidine tag to facilitate purification through affinity chromatography .

The recombinant protein is generally supplied as a lyophilized powder, which maintains stability during storage and transport while allowing for reconstitution in appropriate buffers for experimental applications . This recombinant form enables detailed structural and functional studies that would be challenging to perform with native protein extracted from H. influenzae.

Mutation Studies

Investigation of dppC function has relied significantly on insertional mutagenesis techniques. In key studies, a kanamycin resistance marker was inserted to disrupt codon 290 of the dppC gene in H. influenzae strain Rd KW20 (creating strain TMV1262) . This mutation provided a valuable tool for assessing the functional role of dppC in nutrient acquisition.

Extensive growth curve analyses comparing the dppC mutant with wildtype strains revealed the critical importance of this protein in heme utilization. The mutant strain exhibited significant growth impairment when provided with various heme sources, including free heme, heme-human serum albumin complexes, hemoglobin, and hemoglobin-haptoglobin complexes . These deficits were observed across multiple concentrations of each heme source, demonstrating the fundamental role of dppC in heme acquisition across diverse physiological conditions.

Interestingly, while the dppC mutation significantly impaired heme utilization, it did not completely abolish growth, suggesting the existence of additional periplasmic transport systems capable of heme acquisition . Several potential candidates for these alternative systems have been identified, including the sap operon (comprising SapABCDFZ, located at HI1638-HI1643 in strain Rd KW20) and possibly the OppABCDF proteins .

Complementation Studies

To confirm the direct involvement of dppC in heme acquisition, complementation studies were conducted using plasmid-based expression of the intact dppBCDF gene cluster. A 4100-bp PCR product encompassing the entire dppBCDF cluster, along with 100-bp upstream of the dppB start codon and 110-bp downstream of the dppF stop codon, was amplified from H. influenzae strain Rd KW20 chromosomal DNA .

This amplified region was subsequently cloned into an appropriate vector and introduced into the dppC mutant strain. The complemented strain demonstrated restored growth capabilities when provided with various heme sources, effectively correcting the deficits observed in the dppC mutant . This successful complementation provides definitive evidence for the role of the dppBCDF gene cluster in periplasmic heme acquisition in H. influenzae.

Comparative Analysis with Related Systems

The dppC protein of H. influenzae demonstrates significant homology with corresponding proteins in other bacterial species, most notably Escherichia coli. The DppC protein of E. coli functions as part of the DppABCDF ABC transporter system involved in dipeptide transport, responsible for substrate translocation across the membrane .

In E. coli, when foreign outer membrane heme receptors are expressed, the DppABCDF system can transport both heme and its precursor, 5-aminolevulinic acid (ALA), from the periplasm into the cytoplasm . This functional similarity with the H. influenzae system suggests evolutionary conservation of these transport mechanisms across bacterial species.

A comparative analysis of the protein sequences reveals high sequence identity between H. influenzae dppC and E. coli DppC (61.3%) . Similarly, the other components of this transport system show substantial homology between the two species: DppB (59.6% identity), DppD (73.1% identity), and DppF (74.6% identity) . This high degree of conservation underscores the fundamental importance of these transport systems in bacterial physiology.

Significance and Future Research Directions

The dppBCDF transport system, including the dppC permease protein, represents a critical component of H. influenzae's nutrient acquisition mechanisms, particularly for heme and glutathione transport. Given the absolute requirement of H. influenzae for exogenous porphyrin sources, these transport systems are essential for the organism's survival and pathogenesis in the human host.

Understanding the structural and functional characteristics of dppC and related proteins may provide valuable insights for potential therapeutic interventions. As a critical component of essential nutrient acquisition pathways, the dppBCDF transport system could represent a promising target for novel antimicrobial strategies against H. influenzae infections.

Future research directions might include:

  1. Detailed structural analysis of the dppC protein and the complete dppBCDF complex

  2. Investigation of potential inhibitors targeting this transport system

  3. Further elucidation of the interplay between different nutrient acquisition systems in H. influenzae

  4. Exploration of the potential role of these transport systems in antimicrobial resistance

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary based on the purchasing method or location. For specific delivery timeframes, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
dppC; HI_1186; Dipeptide transport system permease protein DppC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-295
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
dppC
Target Protein Sequence
MSDTPLTFAPKTPLQEFWFYFKQNRGALIGLIFILIVALISILAPYIAPFDPTEQNRTAL LLPPAWYEGGNPAYLLGTDDIGRDILSRIIYGTRISVFAGFIIVLLSCAFGTSLGLISGY YGGVLDTIIIRLIDIMLAIPNLLLTIVVVSILEPSLANATLAIAVVSIPSYVRLTRAAMM NEKNRDYVTSSKVAGAGILRLMFIVILPNCLAPLIVQMTMGISNAILELATLGFLGIGAK PPTPELGTMLSEARGFMQAANWLVTIPGLVILSLVLAFNLMGDGLRDALDPKLKQ
Uniprot No.

Target Background

Function
As a component of the ABC transporter DppBCDF, this protein plays a crucial role in dipeptide transport. It is responsible for the translocation of the substrate across the membrane.
Database Links

KEGG: hin:HI1186

STRING: 71421.HI1186

Protein Families
Binding-protein-dependent transport system permease family, OppBC subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the dppC protein in Haemophilus influenzae?

The dppC protein is a critical component of the dppBCDF gene cluster in Haemophilus influenzae, functioning as a permease protein within an ABC transporter system. This transmembrane protein forms part of the channel through which dipeptides and tripeptides are transported across the bacterial membrane. Research has demonstrated that the dppBCDF gene cluster, including dppC, constitutes a significant part of the periplasmic heme-acquisition systems of H. influenzae, which is essential for bacterial survival and virulence . Insertional mutations in dppC significantly impact the utilization of various heme sources and protoporphyrin IX, highlighting its importance in bacterial metabolism .

How is the dppBCDF gene cluster organized in H. influenzae?

The dppBCDF operon in H. influenzae consists of four genes encoding the components of an ABC transporter system. These genes are sequentially arranged as dppB, dppC, dppD, and dppF. In molecular studies, researchers have successfully amplified a 4100-bp PCR product encompassing the entire dppBCDF gene cluster, including 100-bp upstream of the dppB start codon and 110-bp downstream of the dppF stop codon . This genetic organization facilitates the coordinated expression of all transport system components, ensuring efficient functionality of the dipeptide permease system.

What is the relationship between the dppC protein and bacterial heme utilization?

Experimental evidence has established a strong connection between dppC and heme utilization in H. influenzae. Growth curve analyses comparing wild-type strains with dppC mutants demonstrate that the dppC mutation significantly impairs utilization of all tested heme sources, including free heme at various concentrations (10, 2, and 1 μg/ml), heme-human serum albumin complexes, hemoglobin, and hemoglobin-haptoglobin complexes . Importantly, complementation of the dppC mutation with an intact dppBCDF gene cluster in trans successfully corrected these growth defects, confirming that the dppBCDF transporter system plays a crucial role in heme acquisition .

How can researchers create and validate a dppC knockout mutant in H. influenzae?

Creating a dppC knockout mutant involves several key steps:

  • Insertional mutagenesis: A standard approach involves inserting a selectable marker (such as a kanamycin resistance cassette) into the dppC gene. In published research, a kanamycin resistance marker was inserted to disrupt codon 290 of dppC .

  • Library construction: Researchers can create a chromosomal library by digesting H. influenzae genomic DNA with restriction enzymes (e.g., PvuII), followed by ligating appropriate linkers (e.g., phosphorylated AscI linkers) .

  • Fragment purification: After agarose gel electrophoresis, fragments larger than approximately 2000-bp are purified for downstream applications .

  • Vector construction: Purified fragments are digested with appropriate restriction enzymes and ligated to compatible vectors (e.g., AscI-digested pASC15) .

  • Mutant validation: Confirm the mutation through PCR verification and sequencing to ensure proper insertion at the target site.

To validate the phenotype, growth curve analyses comparing the mutant strain with the wild-type under various heme source conditions provide crucial evidence of functional changes resulting from the mutation .

What methods are effective for studying dppC protein function in vitro?

Several methodological approaches are valuable for studying dppC function:

  • Growth curve analyses: Compare growth of dppC mutants versus wild-type strains in media supplemented with various potential substrates at different concentrations. Statistical analysis should be performed to determine significant differences in growth patterns .

  • Complementation studies: Introduce a functional copy of the dppBCDF operon into the mutant strain using appropriate expression vectors. Restoration of wild-type phenotypes confirms the specific role of dppC in observed mutant characteristics .

  • Transport assays: Measure the uptake of labeled substrates (dipeptides, heme compounds) in wild-type versus mutant strains to directly assess transport function.

  • Expression analysis: Monitor dppC expression levels under different conditions using RT-PCR, RNA-Seq, or reporter gene assays to understand regulatory mechanisms.

  • Protein interaction studies: Investigate interactions between dppC and other components of the transport system using techniques such as co-immunoprecipitation or bacterial two-hybrid systems.

How should growth curve data be analyzed when comparing dppC mutants to wild-type strains?

Proper analysis of growth curve data requires consideration of several factors:

  • Full growth period analysis: Statistical comparison should cover the entire growth period. For example, dppC mutant strains grow significantly less well than wild-type strains when compared over complete growth curves (P < 0.0001) .

  • Phase-specific analysis: Different growth phases should be analyzed separately, as phenotypic differences may be more pronounced in specific phases. For instance, in media with heme at 10 μg/ml, a dppC mutant showed similar growth to wild-type during early growth (first 10 hours, P = 0.9882) but differed significantly over longer periods .

  • Concentration effects: Testing at multiple substrate concentrations (e.g., heme at 10, 2, and 1 μg/ml) reveals concentration-dependent effects of the mutation .

  • Substrate source variation: Different substrate sources may show varying levels of impairment. Researchers should test multiple sources (free heme, heme-human serum albumin, hemoglobin, hemoglobin-haptoglobin complexes) to comprehensively assess the mutation's impact .

  • Growth onset timing: Analysis should include evaluation of lag phase differences, as onset of growth can be significantly delayed for certain substrate sources .

What approaches are effective for complementing a dppC mutation?

Effective complementation strategies include:

  • Full operon complementation: Construct a plasmid carrying the entire dppBCDF operon, including appropriate upstream and downstream regions to ensure proper expression. This approach was successful in research where a 4100-bp PCR product encompassing the complete gene cluster restored wild-type phenotypes in a dppC mutant .

  • Vector selection: Choose vectors appropriate for the bacterial species (with suitable origin of replication and selectable markers).

  • Regulatory element inclusion: Include native promoter regions (approximately 100-bp upstream of dppB) and terminator regions (approximately 110-bp downstream of dppF) to maintain natural expression patterns .

  • Integration vs. plasmid-based approaches: Consider whether chromosomal integration or plasmid-based complementation is more appropriate for the specific research question.

  • Expression verification: Confirm expression of the complemented gene through RT-PCR or Western blotting to validate the complementation system.

How does the dppBCDF system compare between H. influenzae and other bacterial species?

Comparative analysis reveals important differences in the dppBCDF system across bacterial species:

  • Substrate-binding proteins (SBPs): While E. coli has only one protein (DppA) determining transporter specificity, P. aeruginosa possesses five orthologous SBPs (DppA1-A5) . This diversity likely reflects adaptation to different environmental niches and substrate availability.

  • Substrate specificity: In P. aeruginosa, different SBPs show varying substrate preferences. DppA2 demonstrates the highest flexibility in substrate recognition, while DppA2 and DppA4 have higher affinity for tripeptides . Such detailed characterization for H. influenzae SBPs is not fully established.

  • Toxin transport capability: The dppBCDF permease in P. aeruginosa can transport phaseolotoxin (a toxic tripeptide), with DppA1 and particularly DppA3 responsible for delivering this toxin to the permease . Similar toxin transport capabilities in H. influenzae require further investigation.

  • Functional conservation: Despite species-specific differences, the core transport mechanism appears conserved, suggesting fundamental importance in bacterial metabolism and survival.

What is the contribution of dppC to H. influenzae virulence and pathogenesis?

The dppC protein contributes to H. influenzae pathogenesis through several mechanisms:

  • Heme acquisition: H. influenzae is a heme auxotroph requiring external heme sources for survival. The dppBCDF system facilitates uptake of heme from various host sources, including free heme, heme-human serum albumin, hemoglobin, and hemoglobin-haptoglobin complexes .

  • Nutrient acquisition: By enabling dipeptide/tripeptide transport, the system provides essential amino acids and nitrogen sources during infection.

  • Growth in host environments: Experimental evidence shows that dppC mutants exhibit significantly impaired growth when utilizing host-derived heme sources, suggesting reduced survival capacity during infection .

  • Adaptation to microenvironments: The ability to utilize various heme sources with different affinities allows adaptation to changing microenvironments within the host.

Therapeutic approaches targeting the dppBCDF system could potentially reduce bacterial virulence by limiting access to essential nutrients.

How can recombinant dppC protein be effectively expressed and purified?

Successful expression and purification of recombinant dppC requires specialized approaches for membrane proteins:

  • Expression system selection: Choose expression systems optimized for membrane proteins, such as modified E. coli strains (C41/C43), or consider cell-free expression systems.

  • Vector design: Include appropriate affinity tags (His, FLAG, Strep) positioned to avoid interference with protein folding and function.

  • Expression conditions: Optimize induction parameters (temperature, inducer concentration, duration) to balance expression level with proper folding. Lower temperatures (16-20°C) often improve membrane protein folding.

  • Membrane extraction: Use appropriate detergents for solubilization, screening multiple options (DDM, LDAO, FC-12) to identify optimal conditions that maintain protein structure and function.

  • Purification strategy: Implement multi-step purification including affinity chromatography followed by size exclusion chromatography to obtain pure, homogeneous protein.

  • Functional validation: Confirm purified protein functionality through transport assays in reconstituted liposomes or nanodiscs.

What are the common challenges in interpreting dppC functional data?

Researchers face several challenges when interpreting dppC functional data:

  • Pleiotropic effects: The dppBCDF system participates in multiple functions (dipeptide/tripeptide transport, heme utilization), complicating phenotype interpretation .

  • Growth condition variables: Experimental outcomes can vary significantly based on growth conditions. For example, onset of growth for the wild-type strain in both heme-human serum albumin and hemoglobin-haptoglobin complexes appears significantly delayed compared to growth in either heme or hemoglobin, potentially due to concentration differences or varying affinities .

  • Complex regulation: Expression and activity regulation mechanisms may involve multiple environmental signals, creating context-dependent phenotypes.

  • Genetic redundancy: Alternative transport systems with overlapping functions may partially compensate for dppC mutations, masking some phenotypic effects.

  • Technical limitations: Membrane protein research presents inherent technical challenges in expression, purification, and functional characterization.

How can researchers distinguish between direct and indirect effects of dppC mutation?

Distinguishing direct from indirect effects requires multiple complementary approaches:

  • Complementation analysis: Restoration of wild-type phenotypes through complementation with an intact dppBCDF gene cluster confirms direct relationships between the mutation and observed phenotypes .

  • Substrate specificity profiling: Systematically test growth on various potential substrates to identify the specific molecules whose transport is directly affected by the mutation.

  • Gene expression analysis: Compare transcriptional profiles of wild-type and mutant strains to identify downstream effects that may represent indirect consequences of the mutation.

  • Time-course studies: Monitor phenotypic changes over time to distinguish primary (direct) from secondary (indirect) effects.

  • Structure-function analysis: Targeted mutations of specific functional domains can help dissect which aspects of protein function directly relate to observed phenotypes.

What statistical approaches are most appropriate for analyzing complex dppC phenotypes?

When analyzing growth curves comparing dppC mutants to wild-type strains, statistical analysis should be applied to the entire growth period and to specific growth phases separately. In published research, significant differences were observed when comparing growth over the entire period (P < 0.0001), while some specific phases showed comparable growth (P = 0.9882 for early growth) .

What are promising research areas for further understanding dppC function?

Several promising research directions could advance understanding of dppC function:

  • Structural biology: Determine the three-dimensional structure of the dppBCDF complex to understand the molecular basis of substrate recognition and transport.

  • Host-pathogen interactions: Investigate how the dppBCDF system functions during actual host infection, potentially using animal models of H. influenzae infection.

  • Regulatory networks: Elucidate the regulatory mechanisms controlling dppBCDF expression in response to environmental cues and host factors.

  • Therapeutic targeting: Explore the potential of dppC and the dppBCDF system as targets for novel antimicrobial therapies, particularly for H. influenzae infections that are becoming increasingly resistant to conventional antibiotics.

  • Comparative genomics: Expand comparative analyses across additional bacterial species to better understand evolutionary adaptation of this transport system.

How might dppC research contribute to therapeutic development against H. influenzae?

Research on dppC could contribute to therapeutic development through several avenues:

  • Novel target identification: The essential role of dppC in heme utilization makes it a potential target for new antimicrobial agents .

  • Inhibitor design: Structural and functional characterization of dppC could guide rational design of specific inhibitors that block heme transport.

  • Combination therapies: Understanding how dppC contributes to H. influenzae survival in host environments could inform development of combination therapies that target multiple bacterial survival mechanisms.

  • Virulence attenuation: Targeting dppC function could potentially reduce bacterial virulence without directly killing bacteria, potentially reducing selective pressure for resistance development.

  • Diagnostic applications: Knowledge of dppC function and regulation could contribute to development of improved diagnostic approaches for H. influenzae infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.