Recombinant Haemophilus influenzae Disulfide bond formation protein B (dsbB)

Shipped with Ice Packs
In Stock

Description

Biological Role of DsbB in Haemophilus influenzae

DsbB is an inner membrane oxidoreductase that reoxidizes DsbA, a periplasmic enzyme responsible for introducing disulfide bonds into substrate proteins . In H. influenzae, this system supports:

  • Virulence: dsbB mutants exhibit attenuated bacteremia in murine models, indicating its role in bloodstream survival .

  • Heme acquisition: DsbA-dependent disulfide bonds stabilize HbpA, a heme transport protein critical for iron uptake .

  • Protein folding: DsbB transfers electrons to quinones, linking oxidative protein folding to the respiratory chain .

Research Applications

  • Pathogenesis studies: Used to dissect DsbB’s role in H. influenzae virulence and heme acquisition .

  • Protein interaction assays: Recombinant DsbB enables in vitro studies of its interaction with DsbA and quinones .

  • Biocatalyst development: Soluble variants may enhance industrial production of disulfide-rich proteins .

Future Directions

  • Structural studies: Cryo-EM or crystallography to resolve H. influenzae DsbB’s membrane topology.

  • Therapeutic targeting: Inhibitors of DsbB could disrupt bacterial oxidative folding, offering antibiotic potential .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted per your requirements.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its incorporation.
Synonyms
dsbB; NTHI0552; Disulfide bond formation protein B; Disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Haemophilus influenzae (strain 86-028NP)
Target Names
dsbB
Target Protein Sequence
MLALLKQFSEKRFVWFLLAFSSLALESTALYFQYGMGLQPCVLCVYERLAMIGLFVAGII ALLQPLAFILRLIALALGLFSSIKGLLISFRHLDLQMNPAPWKQCEFIPNFPETLPFHQW FPFIFNPTGSCNESQWSLFGLTMVQWLVVIFSLYVVILTLLLIAQVIKTRKQRRLFN
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain periplasmic proteins. It functions by oxidizing the DsbA protein.
Database Links

KEGG: hit:NTHI0552

Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does the DsbA-DsbB redox system regulate protein folding in H. influenzae?

The DsbA-DsbB redox system in H. influenzae operates through a carefully orchestrated electron transfer mechanism. When DsbA introduces disulfide bonds into substrate proteins, it becomes reduced in the process. DsbB then reoxidizes DsbA by transferring electrons from DsbA to the respiratory chain, typically through ubiquinone, thus completing the catalytic cycle and allowing DsbA to oxidize additional substrate proteins.

Studies with H. influenzae DsbA have confirmed its role in introducing disulfide bonds into essential proteins like HbpA, a heme transport protein critical for the organism's aerobic growth . Since H. influenzae cannot synthesize the porphyrin ring independently, proper functioning of heme utilization pathways is vital for its survival . The DsbA-DsbB system ensures the stability and functionality of these transport proteins by catalyzing correct disulfide bond formation.

Research has shown that disruption of dsbA affects both protein localization and natural transformation efficiency in H. influenzae . Given the functional coupling between DsbA and DsbB, disruption of dsbB would likely produce similar phenotypes, highlighting the importance of this redox system in maintaining proper protein folding.

What proteins in H. influenzae require DsbB-mediated disulfide bond formation?

While comprehensive identification of all H. influenzae proteins requiring DsbB-mediated disulfide bond formation remains incomplete, research has identified HbpA (heme transport protein) as a key substrate of the DsbA-DsbB pathway. HbpA contains a DsbA-dependent disulfide bond, as verified through alkylation protection assays . This disulfide bond is critical for HbpA stability and function.

HbpA's dependence on proper disulfide bond formation is particularly significant because H. influenzae requires exogenous heme for aerobic growth, as it cannot synthesize the porphyrin ring . The impaired virulence observed in dsbA mutants is partly attributable to decreased HbpA stability, though the more pronounced defect in dsbA mutants compared to hbpA mutants suggests additional DsbA-dependent factors contributing to pathogenesis .

Other potential substrates likely include secreted virulence factors, periplasmic enzymes, and membrane proteins containing disulfide bonds. In vivo transcriptome analyses have revealed significant metabolic rewiring of H. influenzae during infection , which may involve additional proteins dependent on proper disulfide bond formation for optimal function.

How do structural variations in H. influenzae DsbB affect its interaction with DsbA?

To investigate structural variations affecting DsbB-DsbA interactions, researchers should consider:

  • Site-directed mutagenesis of conserved cysteine residues in the periplasmic loops of DsbB, followed by functional assessment of electron transfer efficiency.

  • Creation of chimeric proteins combining domains from H. influenzae DsbB with those from other bacterial species to identify regions critical for species-specific interactions.

  • Molecular dynamics simulations to predict interaction interfaces and conformational changes during the electron transfer process.

  • Crosslinking studies to capture transient DsbB-DsbA complexes for structural analysis.

What experimental approaches best demonstrate the in vivo function of recombinant H. influenzae DsbB?

Demonstrating the in vivo function of recombinant H. influenzae DsbB requires complementary approaches that assess both molecular function and physiological relevance:

  • Genetic complementation studies:

    • Generate a clean dsbB deletion mutant in H. influenzae

    • Introduce recombinant dsbB on a plasmid or integrated into the chromosome

    • Assess restoration of wild-type phenotypes including virulence in animal models, HbpA stability, and protein secretion profiles

  • In vivo gene expression analysis:

    • Utilize methodologies similar to those described for H. influenzae in vivo transcriptome sequencing during lung infection

    • Compare dsbB expression patterns in different infection sites and growth conditions

    • Correlate expression with virulence phenotypes

  • Substrate protein assessment:

    • Monitor the stability and disulfide bond status of known DsbA-dependent proteins like HbpA in the presence of wild-type versus recombinant DsbB

    • Use alkylation protection assays similar to those employed for verifying DsbA-dependent disulfide bonds in HbpA

  • Animal infection models:

    • Compare bacterial loads in bronchoalveolar lavage fluid from mice infected with wild-type, dsbB mutant, and complemented strains

    • Assess dissemination to blood and other tissues in infant rat models of bacteremia

These approaches provide a comprehensive assessment of recombinant DsbB function in physiologically relevant contexts.

How can researchers distinguish between phenotypes caused by loss of DsbB versus downstream effects on DsbA function?

Distinguishing direct effects of DsbB deficiency from secondary effects due to DsbA dysfunction requires careful experimental design:

  • Comparative phenotypic analysis:

    • Create isogenic strains with mutations in dsbB, dsbA, or both

    • Compare phenotypic profiles across a range of conditions

    • Identify phenotypes unique to dsbB versus those shared with dsbA mutants

  • Suppressor mutation analysis:

    • Introduce mutations that create a constitutively oxidized form of DsbA

    • Determine if these mutations can bypass the requirement for DsbB

    • Identify which phenotypes are rescued and which persist

  • Biochemical assessment of redox states:

    • Use alkylation-based methods to directly measure the redox state of DsbA in wild-type versus dsbB mutant backgrounds

    • Correlate DsbA oxidation levels with specific phenotypes

  • Substrate-specific analyses:

    • Examine the disulfide bond status of multiple substrates in dsbB versus dsbA mutants

    • Identify substrates differentially affected by loss of each protein

This multilayered approach helps delineate the direct roles of DsbB from its indirect effects through DsbA, providing a more nuanced understanding of the disulfide bond formation pathway in H. influenzae.

What are the optimal expression conditions for producing functional recombinant H. influenzae DsbB?

Producing functional recombinant H. influenzae DsbB presents challenges typical of membrane proteins but can be achieved through optimized expression strategies:

  • Expression vector selection:

    • Use vectors with tightly regulated promoters (e.g., pET, pBAD systems)

    • Include purification tags positioned to avoid interference with transmembrane domains

    • Consider fusion partners that enhance membrane protein folding and stability

  • Expression conditions optimization:

    • Reduce expression temperature to 16-20°C to minimize aggregation

    • Use gradual induction with lower inducer concentrations

    • Extend expression time to 16-24 hours for proper membrane integration

  • Host strain selection:

    • E. coli C41/C43 strains engineered for membrane protein expression

    • Strains with reduced proteolytic activity (e.g., BL21(DE3) pLysS)

    • Consider strains with altered membrane composition for better accommodation of heterologous membrane proteins

  • Membrane extraction and protein solubilization:

    • Screen multiple detergents (DDM, LDAO, OG) for optimal solubilization

    • Include stabilizing additives such as glycerol (10-15%) and specific lipids

    • Maintain physiologically relevant pH and ionic strength

These approaches can be adapted from successful strategies used for expressing other H. influenzae proteins in E. coli , with specific modifications to address the membrane protein nature of DsbB.

What purification techniques yield highest activity for recombinant H. influenzae DsbB?

Purifying recombinant H. influenzae DsbB while maintaining its functional activity requires careful selection of purification techniques:

  • Initial capture:

    • Immobilized metal affinity chromatography (IMAC) using His-tagged DsbB

    • Optimize imidazole concentration in wash and elution buffers to minimize non-specific binding while maximizing recovery

    • Maintain detergent concentration above critical micelle concentration throughout

  • Intermediate purification:

    • Ion exchange chromatography to separate differentially charged species

    • Adjust pH to optimize binding based on the theoretical isoelectric point of H. influenzae DsbB

    • Consider using salt gradients rather than step elution for better resolution

  • Polishing step:

    • Size exclusion chromatography to separate monomeric DsbB from aggregates and remove remaining contaminants

    • Select column matrix appropriate for membrane protein-detergent complexes

    • Use multi-angle light scattering to confirm monodispersity

  • Quality control assessments:

    • Circular dichroism to verify secondary structure content

    • Thermal stability assays to confirm proper folding

    • Functional assays measuring electron transfer activity

Throughout purification, maintain reducing agents at concentrations that prevent non-native disulfide formation while allowing native disulfides to form correctly. The specific concentration will depend on the redox potential of the DsbB disulfides.

How can researchers develop reliable activity assays for recombinant H. influenzae DsbB?

Developing reliable activity assays for H. influenzae DsbB requires consideration of its electron transfer function:

  • Coupled DsbA-DsbB oxidation assay:

    • Prepare reduced H. influenzae DsbA as substrate

    • Monitor DsbA oxidation through intrinsic tryptophan fluorescence changes or using thiol-reactive probes

    • Measure reaction rates at varying DsbB concentrations to determine kinetic parameters

  • Ubiquinone reduction assay:

    • Monitor spectrophotometric changes as DsbB transfers electrons to ubiquinone

    • Optimize ubiquinone concentration for linear response

    • Include appropriate controls to distinguish DsbB-specific activity

  • Oxygen consumption measurement:

    • Use Clark-type electrode or fluorescence-based oxygen sensors

    • Reconstitute the complete electron transfer chain from DsbA to DsbB to respiratory components

    • Analyze the effect of specific inhibitors to confirm pathway specificity

  • Substrate protein folding assay:

    • Use HbpA as a physiologically relevant substrate

    • Monitor disulfide bond formation through alkylation protection assays

    • Correlate disulfide formation with functional activity of the substrate

When developing these assays, researchers should validate results using both positive controls (functional DsbB) and negative controls (catalytically inactive DsbB mutants) to establish assay specificity and sensitivity.

How does H. influenzae DsbB activity compare between in vitro biochemical assays and in vivo infection models?

The relationship between in vitro DsbB activity and in vivo function reveals important insights about its physiological role:

ParameterIn vitro biochemical assaysIn vivo infection modelsImplications
Activity measurementDirect electron transfer ratesIndirect through phenotypic outcomesDifferent optimal conditions may apply
Substrate accessibilityLimited to defined substratesFull complement of physiological substratesIn vitro assays may miss important interactions
Redox environmentControlled, homogeneousVariable, compartmentalizedIn vivo environment may modulate activity
Temporal dynamicsStatic measurementsDynamic regulation during infectionExpression timing affects function
Limiting factorsTypically substrate concentrationMay include expression level, localization, or competing pathwaysDifferent rate-limiting steps

Studies of H. influenzae gene expression during infection have revealed significant metabolic rewiring compared to in vitro growth conditions , suggesting that DsbB activity and its impact likely differ between these contexts. For example, different substrate proteins may become critical during different infection stages.

To bridge this gap, researchers should:

  • Compare dsbB expression levels between in vitro and in vivo conditions

  • Identify infection-specific substrates through proteomic approaches

  • Develop activity assays that better mimic the in vivo environment

  • Use site-directed mutants with varying levels of activity to correlate biochemical function with virulence

What bioinformatic approaches best identify potential substrates of the H. influenzae DsbB-DsbA pathway?

Computational identification of DsbB-DsbA pathway substrates requires multi-faceted bioinformatic approaches:

  • Secretome analysis:

    • Identify proteins with predicted signal sequences targeting them to the periplasm or extracellular environment

    • Filter for proteins containing even numbers of cysteine residues

    • Prioritize proteins with conserved cysteine spacing patterns

  • Structural prediction:

    • Use homology modeling to predict protein structures

    • Identify cysteine pairs with appropriate spatial proximity for disulfide formation

    • Calculate accessibility of predicted disulfide bonds

  • Comparative genomics:

    • Identify proteins conserved between H. influenzae and organisms with known DsbA substrates

    • Compare cysteine conservation patterns across species

    • Perform co-evolution analysis between putative substrates and the DsbA-DsbB system

  • Integration with experimental data:

    • Incorporate proteomic data comparing wild-type and dsbA/dsbB mutants

    • Prioritize proteins with altered abundance or migration in mutant strains

    • Correlate with transcriptomic data from infection models

This integrated approach will generate a ranked list of candidate substrates for experimental validation, starting with HbpA as a positive control since it has been experimentally confirmed as a DsbA-dependent protein in H. influenzae .

How can researchers address inactivity of recombinant H. influenzae DsbB in functional assays?

Troubleshooting inactive recombinant DsbB requires systematic investigation of potential issues:

ProblemPotential causeSolution strategies
No detectable activityImproper foldingTry different detergents or lipid compositions; use mild solubilization conditions
Incorrect disulfide statusVerify redox state of catalytic cysteines; optimize buffer redox potential
Missing cofactorsEnsure adequate ubiquinone availability; supplement with respiratory chain components
Low activitySuboptimal assay conditionsOptimize pH, temperature, ionic strength; screen different detergents
Protein instabilityAdd stabilizing agents; reduce purification time; maintain consistently cold temperatures
Inactive conformational stateTry different solubilization and reconstitution methods
Inconsistent resultsSample heterogeneityImprove purification protocol; verify monodispersity by size exclusion chromatography
Oxidative damageInclude appropriate antioxidants; minimize exposure to air; use oxygen-scavenging systems

When troubleshooting, maintain parallel processing of a control protein (e.g., E. coli DsbB) to distinguish protein-specific issues from methodological problems. Additionally, consider developing a complementation assay in a dsbB-deficient bacterial strain as an alternative assessment of functionality.

What controls are essential when evaluating H. influenzae DsbB-mediated disulfide bond formation?

Rigorous control experiments are critical for reliable interpretation of DsbB-mediated disulfide bond formation:

  • Positive controls:

    • Wild-type H. influenzae DsbB protein

    • Known DsbA substrate with verified disulfide bonds (e.g., HbpA)

    • Complete reconstituted system including DsbA, DsbB, and appropriate electron acceptors

  • Negative controls:

    • Catalytically inactive DsbB mutant (cysteine to serine mutations)

    • Reactions performed under strong reducing conditions

    • Heat-denatured enzymes

  • Specificity controls:

    • Non-substrate proteins lacking cysteines

    • Proteins with cysteines not normally forming disulfides

    • DsbA without DsbB to distinguish spontaneous oxidation

  • Methodological controls:

    • Non-specific alkylation controls for disulfide detection assays

    • Time zero samples to establish baselines

    • Buffer-only controls to identify reagent artifacts

  • Calibration standards:

    • Proteins with known numbers of disulfide bonds

    • Quantitative standards for redox state determination

    • Kinetic standards for rate measurements

These controls help distinguish specific DsbB activity from non-enzymatic disulfide formation, substrate-specific effects from general protein oxidation, and true activity from artifacts.

What novel experimental methodologies are advancing research on H. influenzae disulfide bond formation?

Recent methodological advances are transforming research on bacterial disulfide bond formation:

  • In vivo gene expression profiling:

    • Transcriptome sequencing (RNA-seq) of bacteria recovered from bronchoalveolar lavage fluid provides insights into gene expression during actual infection

    • This approach has revealed that H. influenzae undergoes significant metabolic rewiring during infection, highly different from growth in artificial media

    • Similar approaches can be applied to study dsbB expression and the regulation of the disulfide bond formation pathway during infection

  • Redox proteomics:

    • Quantitative redox proteomics techniques can identify proteins undergoing redox changes during infection

    • These methods can directly assess the disulfide proteome in wild-type versus dsbB mutant backgrounds

    • Integration with transcriptomic data provides a multi-omics view of disulfide-dependent processes

  • Genetic manipulation advances:

    • Methods for generating clean deletion mutants and complemented strains in H. influenzae have been well-established

    • These approaches enable precise manipulation of dsbB and related genes

    • Techniques like transposon-based "signature-tagged mutagenesis" have already identified dsbB as a virulence gene candidate

  • Structural biology techniques:

    • Recent advances in membrane protein crystallography and cryo-electron microscopy

    • Nanodiscs and other membrane mimetics for maintaining native-like environments

    • Hydrogen-deuterium exchange mass spectrometry for probing dynamic structural features

These methodological advances provide researchers with powerful tools to investigate the structural, functional, and physiological aspects of the H. influenzae disulfide bond formation pathway with unprecedented resolution.

How might inhibitors of H. influenzae DsbB be developed as potential antimicrobial agents?

The essential role of disulfide bond formation in bacterial pathogenesis makes DsbB an attractive target for antimicrobial development:

Development stageKey considerationsMethodological approaches
Target validationConfirm essentiality in diverse strainsGene deletion studies; animal infection models
Assess impact on virulenceCompare wild-type and dsbB mutant virulence
Evaluate conservation across pathogensBioinformatic analysis of dsbB homologs
Inhibitor screeningDevelop high-throughput assaysFluorescence-based DsbA oxidation assays
Screen diverse chemical librariesFragment-based approaches; natural product libraries
Validate hitsOrthogonal activity assays; binding studies
Lead optimizationImprove potency and selectivityStructure-activity relationship studies
Enhance pharmacokinetic propertiesMedicinal chemistry optimization
Minimize toxicitySelectivity screening against human homologs
Preclinical developmentAssess efficacy in infection modelsAnimal models used for H. influenzae pathogenesis studies
Evaluate resistance developmentSerial passage experiments; resistance mechanism studies
Combination with existing antibioticsSynergy screening with established antimicrobials

The successful development of DsbB inhibitors would represent a novel class of antimicrobials targeting bacterial virulence rather than growth, potentially reducing selective pressure for resistance development. The conservation of the disulfide bond formation pathway across many pathogens suggests potential broad-spectrum activity, while structural differences between bacterial DsbB and mammalian disulfide formation systems offer opportunities for selectivity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.