Recombinant Haemophilus influenzae Electron transport complex protein RnfG (rnfG)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its inclusion in the production process.
Synonyms
rnfG; CGSHiEE_03600; Ion-translocating oxidoreductase complex subunit G; Rnf electron transport complex subunit G
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-207
Protein Length
full length protein
Species
Haemophilus influenzae (strain PittEE)
Target Names
CGSHiEE_03600
Target Protein Sequence
MGTVKITSRYGILLGFIALLCTIISAGIYFLTKDKIDAVIAAQQRELLLQVIPQDYFNNN LLESAVIPQDKNFVGIQKIYFAKKDGNISAYAYETTAPDGYSGDIRLLVGLDPKGEVLGV RVIEHHETPGLGDKIERRISNWILGFTNQSINEHNLSEWAVKKDGGKFDQFSGATITPRA VVNQTKRSALIMLNNQALLQQLSTQVK
Uniprot No.

Target Background

Function
A component of a membrane-bound complex responsible for coupling electron transfer with ion translocation across the membrane.
Database Links
Protein Families
RnfG family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the Rnf complex in Haemophilus influenzae and what role does RnfG play?

The Rnf complex in Haemophilus influenzae is a membrane-bound enzyme that functions as an ion-translocating respiratory complex. It oxidizes reduced ferredoxin and reduces NAD+ (and vice versa), coupled to ion transport across the cytoplasmic membrane. This complex plays a critical role in energy conservation and reverse electron transport in many bacteria, including H. influenzae . RnfG is one of six subunits of the Rnf complex (RnfA, RnfB, RnfC, RnfD, RnfE, and RnfG) and participates in the electron transport pathway. Specifically, RnfG is thought to mediate electron flow from RnfB (the entry point for electrons from reduced ferredoxin) to RnfC (the NAD binding site) . When studying RnfG, it's essential to consider its role within the entire complex rather than as an isolated protein.

What are the general characteristics of Haemophilus influenzae that researchers should consider when working with RnfG?

Haemophilus influenzae is a Gram-negative, coccobacillary, facultatively anaerobic pathogenic bacterium belonging to the Pasteurellaceae family . It was the first free-living organism to have its entire genome sequenced, which facilitates genetic studies. H. influenzae exists in encapsulated (typed a-f) and non-encapsulated (non-typeable or NTHi) forms . When working with RnfG, researchers should consider:

  • Growth conditions: H. influenzae is fastidious and requires specific growth conditions, often including hemin (X factor) and NAD (V factor)

  • Genetic manipulation challenges: Although naturally competent, NTHi strains take up plasmids by transformation very inefficiently and many clinical isolates are refractory to currently available shuttle vectors via electroporation

  • Respiratory metabolism: Understanding the respiratory chain in which the Rnf complex participates is crucial for interpreting RnfG function

What expression systems are recommended for producing recombinant RnfG from Haemophilus influenzae?

For recombinant expression of H. influenzae RnfG, several systems have proven effective, each with distinct advantages:

When selecting an expression system, consider the downstream application (structural studies, functional assays, etc.) and whether membrane association needs to be maintained.

What are the methodological challenges in purifying functional RnfG as part of the intact Rnf complex, and how can they be addressed?

Purification of functional RnfG as part of the intact Rnf complex presents several methodological challenges:

  • Membrane protein solubilization: The Rnf complex has historically "escaped purification" from different microbial sources . Successful solubilization requires careful detergent screening and optimization. The breakthrough with Thermotoga maritima suggests using a combination of mild detergents like dodecyl maltoside or digitonin at concentrations that maintain protein-protein interactions within the complex.

  • Maintaining complex integrity: The six-subunit architecture (including RnfG) must remain intact for functional studies. Implement:

    • Gentle purification conditions with physiological pH and ionic strength

    • Addition of stabilizing agents like glycerol or specific lipids

    • Rapid purification protocols to minimize time in detergent solution

  • Preserving redox cofactors: The Rnf complex contains iron-sulfur clusters, monovalent iron and covalently bound flavins essential for electron transport . Maintain anaerobic conditions throughout purification and include reducing agents to preserve these sensitive cofactors.

  • Functional verification: Develop in vitro assays to confirm that the purified complex containing RnfG maintains Fd2−:NAD+-oxidoreductase activity coupled to Na+ transport. This can be achieved through:

    • Reconstitution into liposomes loaded with Na+-sensitive fluorescent dyes

    • Measurements of NAD+ reduction coupled to ferredoxin oxidation spectrophotometrically

The successful purification from T. maritima provides a methodological framework that can be adapted for H. influenzae Rnf complex .

How can researchers accurately assess the electron transport function of recombinant RnfG within the context of the Rnf complex?

Accurate assessment of recombinant RnfG function within the Rnf complex requires multiple complementary approaches:

  • Spectroscopic techniques to monitor electron transfer:

    • UV-visible spectroscopy to track NAD+ reduction/oxidation (340 nm)

    • EPR spectroscopy to monitor iron-sulfur cluster redox states

    • Fluorescence quenching to observe flavin reduction/oxidation

  • Ion transport measurements:

    • Reconstitution of purified complex into liposomes loaded with Na+-sensitive fluorophores

    • 22Na+ uptake assays for direct measurement of transport

    • Membrane potential measurements using voltage-sensitive dyes

  • Site-directed mutagenesis approach:

    Target Residue TypeExperimental OutcomeFunctional Implication
    Conserved cysteinesLoss of iron-sulfur coordinationEssential for electron transfer
    Charged residues in transmembrane domainsAltered Na+ transport kineticsInvolved in ion channel formation
    Residues at subunit interfacesDisrupted complex assemblyCritical for RnfG positioning
  • Cross-linking studies:
    Identify protein-protein interactions between RnfG and other subunits (particularly RnfA and RnfC) to map the electron transfer pathway .

  • Chimeric protein approach:
    Replace sections of H. influenzae RnfG with corresponding regions from well-characterized Rnf complexes (e.g., from T. maritima) to identify functional domains.

When analyzing results, remember that electron transport and ion translocation are coupled processes, and modifications to RnfG may affect both functions simultaneously.

What approaches can be used to investigate the Na+ transport mechanism associated with the Rnf complex containing RnfG?

To investigate the Na+ transport mechanism associated with the Rnf complex containing RnfG, researchers can employ several sophisticated approaches:

  • Reconstitution studies:

    • Purify the entire Rnf complex including RnfG and reconstitute it into proteoliposomes

    • Create an artificial Na+ gradient and measure electron transport-dependent dissipation

    • Alternatively, drive electron transport and measure resulting Na+ movements

  • Electrophysiological techniques:

    • Patch-clamp measurements of proteoliposomes or bacterial spheroplasts expressing the complex

    • Planar lipid bilayer recordings after incorporation of purified complex

    • These approaches can determine conductance, ion selectivity, and gating properties

  • Molecular dynamics simulations:

    • Based on structural models of the Rnf complex, simulate Na+ movement through potential channels

    • Identify key residues that coordinate Na+ during transport

    • Predict energy landscapes for ion translocation

  • Structure-guided mutagenesis:

    Mutation TargetPredicted EffectExperimental Readout
    Conserved polar residues in RnfD/EAltered Na+ coordinationChanged stoichiometry of Na+/electron
    Putative channel-lining residuesModified ion selectivityShifted cation preference (Na+/K+/H+)
    Interface between RnfG and RnfD/EDisrupted couplingElectron transport without ion movement
  • Isothermal titration calorimetry:

    • Measure binding energetics of Na+ to the purified complex

    • Determine binding stoichiometry and affinity

    • Compare wild-type with RnfG variants to assess contribution to ion binding

The experimental evidence from T. maritima has confirmed that the Rnf complex functions as a primary Na+ pump , providing a valuable comparative system for studies in H. influenzae.

What are the optimal conditions for expressing and purifying recombinant H. influenzae RnfG for structural studies?

For structural studies of recombinant H. influenzae RnfG, optimization at each experimental stage is crucial:

  • Expression system selection:

    • E. coli C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression

    • Consider fusion tags that enhance solubility (MBP, SUMO) while allowing tag removal

    • Use tight expression control (e.g., pET vectors with T7lac promoter) to prevent toxicity

  • Growth and induction parameters:

    ParameterRecommended RangeRationale
    Temperature16-20°CSlows expression, improves folding
    Induction OD6000.6-0.8Optimal cell density for membrane protein expression
    Inducer concentration0.1-0.5 mM IPTGModerate induction prevents aggregation
    Post-induction time16-20 hoursExtended time at low temperature improves yield
  • Membrane preparation and solubilization:

    • Harvest cells and disrupt by French press or sonication in buffer containing protease inhibitors

    • Isolate membranes by ultracentrifugation (100,000×g for 1 hour)

    • Screen detergents systematically (start with DDM, LMNG, digitonin)

    • Include stabilizing agents (glycerol 10%, specific lipids)

  • Purification strategy:

    • Initial capture via affinity chromatography (IMAC for His-tagged constructs)

    • Secondary purification by ion exchange or size exclusion chromatography

    • Consider amphipol or nanodisc reconstitution for long-term stability

    • Concentrate to 5-10 mg/ml for crystallization trials or cryo-EM

  • Quality control:

    • Assess purity by SDS-PAGE (>95% for structural studies)

    • Verify proper folding using circular dichroism

    • Confirm oligomeric state by size exclusion chromatography with multi-angle light scattering

    • For functional validation, reconstitute into liposomes and perform activity assays

For highest resolution structures, consider co-expression with other Rnf components as the native interactions may stabilize RnfG's conformation .

What genetic approaches can be employed to study RnfG function in Haemophilus influenzae?

Several genetic approaches can be employed to study RnfG function in Haemophilus influenzae:

  • Gene knockout and complementation:

    • Generate rnfG deletion mutants using natural transformation or conjugation-based methods

    • Create complementation constructs using broad host range vectors transferable via intergeneric conjugation with E. coli

    • Analyze growth phenotypes under different energy/carbon source conditions

    • Assess changes in membrane potential, intracellular Na+ levels, and NAD+/NADH ratios

  • Site-directed mutagenesis:

    Mutation TypeTarget ResiduesFunctional Assessment
    Alanine scanningConserved charged residuesElectron transfer efficiency
    Conservative substitutionsCysteine residues in iron-sulfur binding motifsCofactor binding and redox properties
    Domain swappingInterface regions with other Rnf subunitsComplex assembly and stability
  • Reporter gene fusions:

    • Create transcriptional or translational fusions to track expression levels

    • Use fluorescent protein fusions to monitor localization and complex assembly

    • Employ the conjugal system allowing expression of marker genes in NTHi strains to track progress in experimental models

  • Conditional expression systems:

    • Develop inducible promoter systems for H. influenzae

    • Create depletion strains where RnfG levels can be modulated

    • Monitor physiological changes as RnfG concentration varies

  • Suppressor mutation analysis:

    • Isolate suppressors of rnfG mutant phenotypes

    • Identify genetic interactions that compensate for RnfG dysfunction

    • Map the broader metabolic network connected to Rnf complex function

These genetic approaches should be combined with biochemical and physiological measurements to provide a comprehensive understanding of RnfG function in the context of H. influenzae energy metabolism.

How can researchers investigate the interaction between RnfG and other subunits of the Rnf complex?

To investigate interactions between RnfG and other Rnf complex subunits, researchers can employ multiple complementary techniques:

  • Co-immunoprecipitation (Co-IP):

    • Generate antibodies against RnfG or epitope-tag the protein

    • Solubilize membranes under mild conditions to preserve protein-protein interactions

    • Precipitate RnfG and identify co-precipitating subunits by Western blotting or mass spectrometry

    • Perform reciprocal experiments pulling down other Rnf subunits

  • Crosslinking mass spectrometry (XL-MS):

    Crosslinker TypeAdvantagesDistance Information
    DSS/BS3 (amine-reactive)General protein surface mapping~11.4 Å spacer
    EDC (zero-length)Direct interaction identificationAdjacent residues only
    Photo-reactive crosslinkersSite-specific insertion possibleVaries with crosslinker

    After crosslinking, digest the complex and analyze by LC-MS/MS to identify linked peptides between RnfG and other subunits .

  • Bacterial two-hybrid systems:

    • Adapt bacterial two-hybrid systems for membrane proteins

    • Test binary interactions between RnfG and each Rnf subunit

    • Map interaction domains by creating truncated constructs

  • FRET-based approaches:

    • Tag RnfG and potential partner subunits with fluorescent protein pairs

    • Measure FRET efficiency in membrane preparations or intact cells

    • Use acceptor photobleaching to confirm specific interactions

  • Surface plasmon resonance or microscale thermophoresis:

    • Purify individual Rnf components including RnfG

    • Measure direct binding kinetics and affinities

    • Determine effects of mutations on binding parameters

  • Disulfide crosslinking:

    • Introduce cysteine pairs at predicted interfaces between RnfG and other subunits

    • Induce disulfide formation under oxidizing conditions

    • Analyze crosslinked products by non-reducing SDS-PAGE

Combining structural predictions with the experimental approaches above will create a detailed interaction map of RnfG within the Rnf complex architecture, advancing understanding of electron flow through the complex .

How can researchers resolve apparent discrepancies in electron transfer efficiency data when studying recombinant RnfG?

When facing discrepancies in electron transfer efficiency data for recombinant RnfG, researchers should implement a systematic troubleshooting approach:

  • Identify sources of experimental variability:

    Potential VariableImpact on MeasurementsControl Strategy
    Protein preparation heterogeneityInconsistent activityStandardize purification protocols, verify integrity by SEC
    Cofactor loss during purificationReduced electron transfer capacityAdd cofactors during reconstitution, purify anaerobically
    Lipid environment differencesAltered membrane protein functionStandardize lipid composition in reconstitution experiments
    Redox state of samplesPre-oxidized/reduced centersPrepare samples with defined redox poising
  • Reconcile in vitro vs. in vivo data:

    • In vitro systems may lack essential components present in the cellular environment

    • Create more complex reconstitution systems that include additional cellular factors

    • Develop whole-cell assays that can correlate with purified protein studies

  • Account for RnfG conformational heterogeneity:

    • Use mild detergents and amphipols to maintain native-like environments

    • Consider time-resolved measurements to capture transient states

    • Employ single-molecule techniques to detect functional heterogeneity

  • Statistical approaches:

    • Implement robust statistical methods appropriate for non-normal distributions

    • Use larger sample sizes to account for inherent variability

    • Apply Bayesian analysis to integrate prior knowledge with new experimental data

  • Model refinement:

    • Develop kinetic models that account for observed variations

    • Incorporate temperature, pH, and ionic strength dependencies

    • Use global fitting approaches across multiple experimental conditions

When reconciling contradictory results, consider that the most informative approach may be to embrace the variability as biologically meaningful rather than experimental error, particularly when studying dynamic membrane protein complexes like RnfG .

What are common pitfalls in interpreting localization data for RnfG in Haemophilus influenzae and how can they be avoided?

Interpreting localization data for RnfG in Haemophilus influenzae presents several challenges that researchers should address:

  • Fixation artifacts in microscopy:

    • Chemical fixation can alter membrane protein distribution

    • Compare multiple fixation methods or use live-cell imaging where possible

    • Include appropriate controls for fixation-induced redistribution

  • Tag interference with localization:

    Tag TypePotential IssueMitigation Strategy
    Fluorescent proteinsSize can disrupt membrane insertionUse smaller tags (e.g., FlAsH) or split-GFP approaches
    Epitope tagsMay mask targeting signalsPlace tags at multiple positions, verify function is preserved
    Enzymatic tagsActivity may be context-dependentValidate accessibility in membrane environment
  • Overexpression artifacts:

    • Non-physiological expression levels can cause mislocalization

    • Use native promoters or titratable expression systems

    • Compare with immunolocalization of endogenous protein when possible

  • Membrane fractionation challenges:

    • Incomplete separation of membrane fractions leads to contamination

    • Use multiple fractionation methods (density gradients, differential detergent extraction)

    • Include markers for different membrane systems as controls

  • Temporal dynamics considerations:

    • RnfG localization may change with growth phase or environmental conditions

    • Implement time-course studies rather than single time point analyses

    • Consider inducible systems to track newly synthesized RnfG

  • Statistical analysis of microscopy data:

    • Avoid cherry-picking fields or cells

    • Quantify distribution patterns across large numbers of cells

    • Apply appropriate statistical tests for distribution comparisons

To generate the most reliable data, combine biochemical fractionation with multiple imaging approaches, and validate findings with functional assays that depend on correct localization of the Rnf complex .

How should researchers interpret changes in growth phenotypes when manipulating RnfG expression in Haemophilus influenzae?

Interpreting growth phenotypes resulting from RnfG manipulation requires careful consideration of multiple factors:

  • Establish appropriate growth conditions for phenotype detection:

    Growth ConditionExpected PhenotypeRationale
    Fermentative (anaerobic)Stronger growth defects in rnfG mutantsHigher dependency on Rnf complex for energy conservation
    Different carbon sourcesSubstrate-specific effectsMay reveal conditional importance of Rnf-dependent electron transport
    Na+-limited mediaAltered Na+ dependencyTests Na+ coupling function of Rnf complex
    Stress conditionsEnhanced sensitivityMay reveal secondary roles of RnfG
  • Quantitative growth analysis approaches:

    • Use high-resolution growth curves rather than endpoint measurements

    • Calculate multiple parameters (lag phase, maximum growth rate, final density)

    • Implement competition assays between wild-type and mutant strains for subtle phenotypes

  • Distinguish direct from indirect effects:

    • Measure membrane potential and intracellular Na+/H+ to link to Rnf function

    • Assess NAD+/NADH and ferredoxin redox states to confirm electron transport disruption

    • Perform metabolomic analysis to identify pathway adaptations

  • Complementation controls:

    • Express wild-type RnfG from different promoters to assess dose-dependency

    • Use site-directed mutants to correlate specific RnfG functions with phenotypes

    • Include heterologous RnfG proteins from related organisms to assess conservation

  • Adaptive responses and suppressor mutations:

    • Extended cultivation may select for compensatory mutations

    • Genome sequencing of adapted strains can reveal genetic interactions

    • Transcriptomic analysis can identify upregulated alternative pathways

For complex growth phenotypes, integrate physiological measurements with omics approaches to develop a systems-level understanding of how RnfG manipulation affects H. influenzae metabolism and energy conservation .

What emerging technologies could advance our understanding of RnfG structure and function in the Rnf complex?

Several cutting-edge technologies hold promise for advancing our understanding of RnfG structure and function:

  • Cryo-electron microscopy advancements:

    • Single-particle cryo-EM for high-resolution structure determination

    • Cryo-electron tomography of Rnf complexes in native membrane environments

    • Time-resolved cryo-EM to capture different conformational states during electron transport

  • Integrative structural biology approaches:

    TechniqueInformation ProvidedComplementarity
    Hydrogen-deuterium exchange MSDynamic regions, solvent accessibilitySupplements static structures
    Solid-state NMRLocal structure in membrane environmentProvides atomic details of specific regions
    AlphaFold2 and RoseTTAFoldPredicted structures from sequenceStarting models for experimental validation
  • Advanced spectroscopic methods:

    • Pulse EPR techniques (DEER/PELDOR) to measure distances between cofactors

    • Time-resolved spectroscopy to track electron transfer events

    • 2D IR spectroscopy to probe structural dynamics during function

  • Single-molecule approaches:

    • Single-molecule FRET to observe conformational changes during electron transport

    • Patch-clamp fluorometry to correlate ion transport with structural changes

    • High-speed AFM to visualize Rnf complex dynamics in membranes

  • Synthetic biology and directed evolution:

    • Create minimal Rnf systems with defined components

    • Develop selection systems for enhanced or altered RnfG function

    • Engineer orthogonal electron transport systems based on RnfG

  • In-cell structural biology:

    • Intracellular footprinting methods

    • In-cell NMR to observe RnfG in its native environment

    • Correlative light and electron microscopy to link function and structure

These technologies, particularly when applied in combination, have the potential to resolve outstanding questions about RnfG's precise role in electron transport and energy conservation within the Rnf complex .

What potential applications could arise from a deeper understanding of H. influenzae RnfG and the Rnf complex?

A deeper understanding of H. influenzae RnfG and the Rnf complex could enable several innovative applications:

  • Antimicrobial development:

    • The Rnf complex represents a potential novel antibiotic target

    • Structure-based drug design targeting RnfG or its interactions

    • Development of inhibitors specific to pathogenic Haemophilus species

    • Combination therapies targeting energy conservation systems

  • Biotechnology applications:

    Application AreaPotential DevelopmentScientific Basis
    Bioenergy productionEngineered electron transport systemsManipulation of energy conservation efficiency
    BiosensorsNa+ flux detection systemsCoupling of electron transfer to ion movement
    Synthetic biologyModular redox componentsRnfG as a building block for artificial electron transport chains
  • Metabolic engineering:

    • Manipulation of NAD+/NADH and ferredoxin redox balances in industrial microorganisms

    • Enhancement of product yields through improved energy conservation

    • Creation of strains with altered ion requirements or tolerances

  • Fundamental bioenergetics:

    • Models for the evolution of respiratory chains

    • Understanding the diversity of ion-translocating systems

    • Insights into the coupling mechanisms between electron and ion transport

  • Vaccine development:

    • Identification of conserved epitopes in RnfG across Haemophilus strains

    • Development of attenuated strains with modified energy metabolism

    • Construction of conjugate vaccines using recombinant RnfG components

  • Diagnostic applications:

    • Detection of H. influenzae based on Rnf complex components

    • Differentiation between typeable and non-typeable strains

    • Rapid identification of antibiotic susceptibility based on energy metabolism

These applications highlight how basic research on bacterial respiratory complexes can translate into diverse technological and medical advances .

What are the current knowledge gaps regarding the role of RnfG in Haemophilus influenzae pathogenesis?

Several significant knowledge gaps exist regarding RnfG's role in H. influenzae pathogenesis:

  • Expression and regulation during infection:

    • How RnfG expression changes during different stages of infection remains poorly characterized

    • The environmental signals that regulate rnfG expression in host environments are unknown

    • Whether RnfG is differentially expressed in various infection sites (middle ear, lungs, bloodstream) is unclear

  • Contribution to in vivo survival:

    Research QuestionCurrent Knowledge GapExperimental Approach
    Oxygen-limited nichesRole of Rnf in microaerobic/anaerobic host environmentsIn vivo imaging of redox states during infection
    Nutrient limitationImportance during carbon/energy source restrictionMetabolomic analysis of rnfG mutants in infection models
    Immune evasionPotential role in resistance to oxidative burstNeutrophil killing assays comparing wild-type and mutants
  • Strain-specific variations:

    • Functional differences in RnfG between typeable and non-typeable H. influenzae strains

    • Sequence variations that may correlate with virulence or tissue tropism

    • Whether clinical isolates show adaptations in RnfG structure or regulation

  • Host interaction effects:

    • Potential immunomodulatory roles of RnfG or Rnf complex activity

    • Effects on host cell energy metabolism during intracellular infection phases

    • Influence on biofilm formation and persistence

  • Therapeutic targeting potential:

    • Vulnerability of RnfG to inhibition during infection

    • Whether RnfG inhibition would synergize with existing antibiotics

    • Possible development of resistance mechanisms against RnfG-targeted therapeutics

Addressing these knowledge gaps will require integration of molecular genetics, animal models of infection, and human clinical studies. The development of conjugal expression systems for H. influenzae enables tracking of microbe progress in experimental models, facilitating such research .

How does the RnfG protein from Haemophilus influenzae compare structurally and functionally to homologs in other bacterial species?

A comparative analysis of RnfG across bacterial species reveals important evolutionary patterns and functional implications:

  • Sequence conservation patterns:

    Bacterial GroupRnfG Conservation LevelFunctional Implications
    Pasteurellaceae familyHighly conserved (>80% identity)Core function in closely related species
    Other Gamma-proteobacteriaModerate conservation (40-60% identity)Similar function with some specialization
    Distant bacteria (e.g., T. maritima)Low sequence identity (<30%) but conserved motifsFundamental mechanism preserved despite divergence
  • Domain architecture variations:

    • Most bacterial RnfG proteins maintain a similar size and domain organization

    • The N-terminal domain typically contains conserved cysteine motifs for cofactor binding

    • The greatest variation occurs in transmembrane regions, suggesting adaptation to different membrane environments

  • Functional adaptations:

    • In anaerobes like T. maritima, the Rnf complex functions as a primary Na+ pump

    • In facultative organisms like H. influenzae, the complex may have adaptations for function under varying oxygen tensions

    • Some species show coupling to H+ rather than Na+, representing an important functional divergence

  • Genomic context:

    • The organization of rnf genes differs between species

    • Associated regulatory elements vary, suggesting different expression patterns

    • Co-occurrence with specific metabolic genes provides clues to physiological roles

  • Experimental comparisons:

    • The successful purification and characterization of the T. maritima Rnf complex provides a valuable reference point

    • Complementation experiments with RnfG from different species can assess functional conservation

    • Chimeric proteins combining domains from different species can identify critical regions

This comparative analysis highlights both the conservation of core RnfG function in electron transport and the adaptations that have occurred during bacterial evolution to suit different ecological niches and metabolic strategies .

How do experimental approaches for studying RnfG need to be adapted for different bacterial expression systems?

Experimental approaches for studying RnfG require specific adaptations based on the bacterial expression system employed:

  • E. coli expression system considerations:

    ParameterAdaptation RequiredRationale
    Codon optimizationMay be necessary for H. influenzae genesDifferent codon usage bias between species
    Membrane incorporationUse specialized strains (C41/C43)Better tolerance for membrane protein expression
    Cofactor availabilitySupplement with iron and cysteineEnsure proper iron-sulfur cluster formation
    Expression temperatureLower to 16-20°CSlower expression improves folding
  • Native H. influenzae expression:

    • Utilize conjugal transfer systems that overcome transformation inefficiency

    • Implement inducible promoters calibrated for H. influenzae physiology

    • Account for fastidious growth requirements (hemin, NAD)

    • Consider microaerobic or anaerobic growth conditions to match native Rnf function

  • Other bacterial hosts:

    • For anaerobic expression, consider Bacteroides or Clostridium species

    • For high yield, Bacillus subtilis systems may be appropriate

    • For membrane protein studies, Rhodobacter species offer native photosynthetic membranes

  • Purification strategy modifications:

    • Detergent selection must be optimized for each host's membrane composition

    • Extraction conditions (pH, salt) need adjustment based on membrane properties

    • Purification buffers should mirror the ionic environment of the expression host

  • Functional assay adaptations:

    • Control experiments must account for host background activity

    • Reconstitution conditions should reflect the native lipid environment

    • Activity measurements must consider different optimal temperature ranges

The choice of expression system should be guided by the experimental goals, with E. coli offering ease and yield, while expression in H. influenzae provides the most physiologically relevant context despite technical challenges .

What innovative approaches can be developed to study the real-time dynamics of electron transport through RnfG in living H. influenzae cells?

Studying real-time electron transport dynamics through RnfG in living H. influenzae cells requires innovative methodological approaches:

  • Genetically encoded redox sensors:

    • Develop RnfG fusion constructs with redox-sensitive fluorescent proteins

    • Engineer fluorescent proteins sensitive to NAD+/NADH ratios near the Rnf complex

    • Create FRET-based sensors that report on conformational changes during electron transport

  • Advanced microscopy techniques:

    TechniqueApplication to RnfGTechnical Considerations
    FLIM (Fluorescence Lifetime Imaging)Detect environmental changes around RnfGRequires specific fluorophores with lifetime sensitivity
    Super-resolution microscopyVisualize Rnf complex organizationNeed for sparse labeling, photoconvertible fluorophores
    Light-sheet microscopyObserve dynamics with reduced phototoxicityAdaptation for bacterial cell size
  • Electrochemical approaches:

    • Develop bioelectrochemical systems with H. influenzae biofilms

    • Measure electron flow to external acceptors mediated by the Rnf complex

    • Use redox mediators to interface with cellular electron transport chains

  • Raman spectroscopy:

    • Apply surface-enhanced Raman spectroscopy to detect redox changes

    • Develop resonance Raman approaches targeting iron-sulfur clusters

    • Implement time-resolved measurements to capture electron transfer events

  • Microfluidic platforms:

    • Create systems that allow rapid modulation of environmental conditions

    • Integrate with real-time imaging of cellular responses

    • Develop single-cell isolation and analysis capabilities

  • Biosensor cells:

    • Engineer reporter strains where fluorescence or luminescence is coupled to Rnf activity

    • Create genetic circuits that amplify signals from electron transport events

    • Develop cell-based biosensors for high-throughput screening applications

These innovative approaches overcome traditional limitations in studying membrane-bound electron transport systems and enable new insights into how RnfG functions within the living bacterial cell environment .

What are the most effective strategies for generating and verifying site-directed mutations in RnfG for structure-function studies?

Effective site-directed mutagenesis strategies for RnfG structure-function studies should follow a comprehensive workflow:

  • Target selection based on integrated analysis:

    Data SourceInformation ProvidedMutation Priority
    Sequence conservationEvolutionarily important residuesHigh priority for conserved positions
    Structural predictionsResidues in functional domainsFocus on cofactor binding, interfaces
    Homology to characterized proteinsFunction by analogyTarget residues with known roles in homologs
    Computational modelingPredicted functional hotspotsHigh priority for energy-minimum sites
  • Mutagenesis method selection:

    • QuikChange or equivalent PCR-based methods for simple substitutions

    • Gibson Assembly for complex or multiple mutations

    • CRISPR-Cas9 for direct chromosomal editing in H. influenzae

    • Recombineering approaches for scarless mutations

  • Mutation types for comprehensive analysis:

    • Conservative substitutions (e.g., Asp to Glu) to test charge requirements

    • Radical substitutions to disrupt function completely

    • Alanine scanning to identify essential side chains

    • Introduction of reporter residues (e.g., cysteine for labeling)

  • Verification strategy:

    • DNA sequencing to confirm intended mutations

    • Western blotting to verify protein expression

    • Membrane fractionation to confirm proper localization

    • Mass spectrometry for final verification of protein sequence

  • Functional validation approach:

    • Develop activity assays specific to the targeted function

    • Compare wild-type and mutant proteins under identical conditions

    • Include positive and negative controls for each assay

    • Implement dose-response measurements where applicable

  • Structural confirmation:

    • Circular dichroism to verify secondary structure retention

    • Limited proteolysis to assess fold integrity

    • Thermal stability assays to detect destabilizing effects

    • When possible, structural determination of mutant proteins

Particularly challenging for H. influenzae is the implementation of mutations in the native context. The use of conjugal transfer systems that overcome transformation inefficiency in clinical isolates provides an effective solution for introducing these mutations into the chromosome .

How can systems biology approaches integrate RnfG function into the broader metabolic network of Haemophilus influenzae?

Systems biology approaches can effectively integrate RnfG function into the broader metabolic network of H. influenzae through several methodologies:

  • Genome-scale metabolic modeling:

    • Incorporate the Rnf complex into existing H. influenzae metabolic models

    • Simulate flux distributions under various conditions, with and without functional RnfG

    • Perform in silico knockouts to predict systemic effects of RnfG disruption

    • Identify synthetic lethal interactions that reveal metabolic dependencies

  • Multi-omics integration:

    Omics LayerContribution to UnderstandingIntegration Approach
    TranscriptomicsCo-expression patterns with RnfGNetwork correlation analysis
    ProteomicsProtein-protein interaction networkAffinity purification-MS studies
    MetabolomicsMetabolic consequences of RnfG functionDifferential analysis of wild-type vs. mutants
    FluxomicsActual metabolic flows affected by RnfG13C metabolic flux analysis
  • Regulatory network analysis:

    • Identify transcription factors controlling rnfG expression

    • Map signaling pathways that modulate Rnf complex activity

    • Define the regulon associated with energy metabolism regulation

    • Characterize feedback mechanisms linking electron transport to gene expression

  • Mathematical modeling of electron transport:

    • Develop kinetic models of the Rnf complex integrated with cellular redox balance

    • Simulate the effects of environmental perturbations on electron flow

    • Model the thermodynamics of coupled Na+ transport and electron transfer

    • Create multi-scale models linking molecular events to cellular phenotypes

  • Evolutionary systems biology:

    • Compare Rnf systems across bacterial lineages

    • Identify co-evolved metabolic pathways

    • Reconstruct the evolutionary history of electron transport diversification

    • Predict functional interactions based on phylogenetic profiles

These integrative approaches will position RnfG within its complete physiological context, revealing how this component of the electron transport machinery influences global cellular functions, particularly under the varying conditions encountered during H. influenzae infection and colonization .

How might artificial intelligence and machine learning approaches accelerate research on RnfG and the Rnf complex?

Artificial intelligence and machine learning approaches offer significant potential to accelerate research on RnfG and the Rnf complex:

  • Structural prediction and analysis:

    • Apply AlphaFold2 or RoseTTAFold to predict RnfG structure with high confidence

    • Use deep learning to predict protein-protein interactions within the Rnf complex

    • Implement ML-based refinement of experimental structural data

    • Develop neural networks that predict conformational changes during function

  • Functional site prediction:

    ML ApproachApplication to RnfGExpected Outcome
    Graph neural networksIdentify electron transfer pathwaysPredicted residues critical for electron flow
    Attention-based modelsDetect functional motifsHighlighted regions for targeted mutagenesis
    Recurrent neural networksPredict sequential electron transfersTemporal model of electron flow through complex
  • Experimental design optimization:

    • Active learning approaches to guide mutagenesis experiments

    • Bayesian optimization for recombinant expression conditions

    • Reinforcement learning for automated protein purification protocols

    • ML-guided design of synthetic Rnf variants with desired properties

  • Literature mining and knowledge integration:

    • Natural language processing to extract RnfG-related information from literature

    • Knowledge graph construction connecting RnfG to related proteins and functions

    • Automated hypothesis generation based on distributed knowledge

    • Identification of understudied aspects for focused research

  • Data analysis and interpretation:

    • Deep learning for spectroscopic data interpretation

    • Automated analysis of microscopy images

    • Pattern recognition in growth and phenotypic data

    • Integration of heterogeneous experimental results

  • High-throughput screening analysis:

    • ML models to predict compound effects on Rnf complex function

    • Virtual screening for potential RnfG-targeting molecules

    • Analysis of large-scale mutagenesis data to build predictive models

    • Classification of phenotypic outcomes from genetic screens

These AI/ML approaches could dramatically accelerate research by reducing experimental iterations, extracting more information from existing data, and generating novel hypotheses that may not be apparent through traditional analysis approaches. The tabular foundation models being developed for diverse scientific applications could be particularly valuable for analyzing the complex datasets generated in RnfG research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.