Recombinant Haemophilus influenzae Ferredoxin-type protein napH homolog (napH)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery time details.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during the production process. If you have a preferred tag type, please inform us, and we will prioritize its implementation.
Synonyms
napH; HI_0346; Ferredoxin-type protein NapH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-287
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
napH
Target Protein Sequence
MANAPKFAGKESREKWGWWYANRFLFWRRLSQLSILAMFLSGPYFGVWILKGNYSGSLLL DTIPLSDPLITAESLAARHLPDALTLIGAAIIVLFYAVLGSKVFCGWVCPLNVVTDCAAW LRRKLGIRQTAKISRGLRYGILVLILLGSSVSGMLLWEWVNPVAALGRAFVFGFGATGWL LLVIFLFDLLIAEHGWCGHLCPIGAAYGVIGAKSLIRIKVIDRAKCDNCMDCYNVCPEAQ VLRSPLHGKKDESLLVLSKDCISCGRCIDVCAEKVFKFSTRFDHSGE
Uniprot No.

Target Background

Function
This protein is essential for electron transfer from ubiquinol, through NapC, to the periplasmic nitrate reductase NapAB complex.
Database Links

KEGG: hin:HI0346

STRING: 71421.HI0346

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the napH protein in Haemophilus influenzae and what is its functional significance?

The napH protein in Haemophilus influenzae is a ferredoxin-type protein that functions as a component of the periplasmic nitrate reductase system. As an electron transport protein, it plays a crucial role in anaerobic respiration pathways, allowing H. influenzae to utilize nitrate as a terminal electron acceptor under oxygen-limited conditions. This capability is particularly important given that H. influenzae is a common inhabitant of the upper respiratory tract where oxygen availability can be limited . The protein contains iron-sulfur clusters that facilitate electron transfer during respiratory processes, making it essential for bacterial energy metabolism under specific environmental conditions.

What expression systems are most effective for producing recombinant H. influenzae proteins?

For recombinant expression of H. influenzae proteins, T7 promoter-based expression systems have proven highly effective. Researchers have successfully employed recombinant DNA technology to replace the N-terminal lipid modification signal sequence with one for protein secretion without such modification, placing expression under control of the T7-inducible promoter . This approach allows for high levels of protein expression after IPTG induction. The pET expression system is particularly suitable for H. influenzae proteins due to its tight regulation and high expression yields. When working with membrane-associated proteins like napH, it's advisable to optimize expression conditions by testing various temperatures (16-37°C) and IPTG concentrations (0.1-1.0 mM) to prevent inclusion body formation and maintain protein solubility.

What are the optimal purification strategies for maintaining the integrity of iron-sulfur clusters in recombinant napH protein?

Purification of recombinant napH protein while preserving its iron-sulfur clusters requires careful consideration of several factors. A two-step chromatography approach has proven effective for similar H. influenzae proteins . The first recommended step is affinity chromatography (typically His-tag based IMAC) performed under anaerobic conditions with buffers containing 5-10% glycerol and 1-5 mM dithiothreitol (DTT) to prevent oxidation of the iron-sulfur clusters. This should be followed by gel filtration chromatography to achieve high purity while allowing proper partitioning within the chromatography matrix . Throughout purification, it's crucial to:

  • Maintain anaerobic conditions using a glove box or by bubbling buffers with argon/nitrogen

  • Include reducing agents (DTT, 2-mercaptoethanol, or sodium dithionite) in all buffers

  • Avoid freezing-thawing cycles that can destabilize the iron-sulfur clusters

  • Use spectroscopic methods (UV-visible absorption at 400-420 nm) to monitor the integrity of iron-sulfur clusters during purification

How can in vivo RNA-seq data be leveraged to optimize expression conditions for napH and related electron transport proteins?

In vivo RNA-seq data provides valuable insights for optimizing napH expression by revealing the natural regulatory mechanisms and metabolic context of the protein. Transcriptomic analysis of H. influenzae recovered from bronchoalveolar lavage fluid samples has shown significant metabolic rewiring during in vivo growth compared to standard in vitro conditions . To leverage this data:

  • Identify co-expressed genes from the transcriptomic data to understand the operon structure and regulatory elements controlling napH expression

  • Analyze the metabolic pathways upregulated during in vivo growth, particularly focusing on nutrient acquisition systems and biosynthetic pathways that may influence napH expression

  • Design growth media that mimics the in vivo nutritional environment by incorporating components that address the bacterial metabolic requirements identified in transcriptomic studies

  • Use dual transcriptome approaches to identify host factors that might influence bacterial gene expression, potentially revealing conditions that naturally induce napH expression

It's important to note that artificial media designed to mimic host environments (like synthetic sputum media) may not accurately reflect the in vivo conditions, as demonstrated by significant differences observed in transcriptomic profiles .

What strategies can be employed to overcome challenges in expressing membrane-associated proteins like napH?

Expressing membrane-associated proteins like napH presents unique challenges that can be addressed through several specialized approaches:

StrategyImplementationAdvantagesConsiderations
N-terminal modificationReplace lipid modification signal sequence with protein secretion signalFacilitates extraction from bacterial membrane; increases solubility May alter protein conformation or activity
Fusion tagsAdd solubility-enhancing tags (MBP, SUMO, TrxA)Improves solubility; aids purificationMay require tag removal for functional studies
Codon optimizationAdjust codon usage to match expression hostEnhances translation efficiencyMay alter mRNA secondary structure
Expression temperatureLower to 16-20°C during inductionSlows protein folding; reduces inclusion body formationExtends expression time required
Membrane mimeticsUse detergents, nanodiscs, or amphipolsMaintains native protein environmentRequires optimization of mimetic system

The most effective approach often involves combining these strategies. For napH homologs, replacing the N-terminal lipid modification signal sequence with one for protein secretion has proven particularly effective, allowing for easier extraction from the bacterial membrane while maintaining the protein's fundamental properties .

How can we accurately assess the substrate specificity and electron transfer capabilities of recombinant napH?

Accurate assessment of substrate specificity and electron transfer capabilities of recombinant napH requires a multi-faceted approach:

  • Spectroscopic Characterization: UV-visible spectroscopy to monitor the iron-sulfur clusters' redox state changes upon interaction with potential electron donors/acceptors.

  • Electrochemical Methods: Protein film voltammetry to determine the redox potentials of the iron-sulfur clusters and evaluate electron transfer kinetics with physiological partners.

  • Enzymatic Assays: Coupling napH to its native electron transfer partners and measuring the rate of nitrate reduction using colorimetric or amperometric detection of nitrite formation.

  • Isothermal Titration Calorimetry (ITC): Determine binding affinities for various electron donors and acceptors to establish substrate preferences.

  • Structural Analysis: Combined with functional data, structural information (from X-ray crystallography or cryo-EM) can reveal substrate binding sites and electron transfer pathways.

When assessing the specificity, it's important to compare the recombinant napH with the native protein to ensure that the expression system hasn't altered its fundamental properties. Physicochemical characterization should evaluate parameters similar to those used for wild-type proteins, including substrate specificity, pH optimum, and sensitivity to various inhibitors .

How does napH expression change during H. influenzae adaptation to the host environment?

H. influenzae undergoes substantial gene expression reprogramming upon infection, including changes in electron transport chain components like napH. In vivo transcriptome sequencing (RNA-seq) of bacteria recovered from mouse lung infections has revealed significant metabolic rewiring that differs markedly from in vitro growth conditions . Several patterns emerge regarding electron transport proteins:

  • Nutrient Adaptation: The expression of electron transport proteins is tightly linked to available electron acceptors in the host environment.

  • Microaerobic Adjustment: In the oxygen-limited environment of mucosal surfaces, alternative respiratory pathways including nitrate reduction (involving napH) are upregulated.

  • Stress Response Integration: Oxidative and nitrosative stress responses in the host modulate the expression of electron transport components.

  • Metabolic Pathway Shifts: The upregulation of de novo biosynthetic pathways in vivo correlates with changes in electron transport chain composition to support these energy-demanding processes .

The expression of napH and related proteins likely fluctuates depending on the specific niche within the host (e.g., biofilm vs. planktonic growth, upper vs. lower respiratory tract), making it important to consider the spatial and temporal context when studying its function.

What roles might napH play in H. influenzae biofilm formation and persistence?

The napH protein likely contributes significantly to H. influenzae biofilm formation and persistence through several mechanisms:

  • Alternative Respiration: In biofilms, where oxygen gradients exist, napH-mediated nitrate respiration provides an alternative energy generation pathway for cells in oxygen-depleted regions.

  • Redox Balancing: By facilitating electron transfer to alternative acceptors, napH helps maintain redox homeostasis within the biofilm, particularly important since metabolomic analyses have revealed distinct metabolic traits in H. influenzae biofilm communities .

  • Microenvironment Adaptation: The ability to use alternative electron acceptors via napH enables adaptation to the changing microenvironment within biofilms as they mature.

  • Stress Response: Iron-sulfur proteins like napH may play roles in managing oxidative stress encountered during host immune responses, contributing to persistence.

Experimental approaches to investigate these roles should include:

  • Comparison of wild-type and napH-deficient strains for biofilm formation capacity

  • Transcriptomic analysis of napH expression in different biofilm regions and maturation stages

  • Visualization of metabolic activity within biofilms using redox-sensitive fluorescent probes

  • Assessment of biofilm resistance to oxidative stress and antimicrobials in relation to napH function

How can multi-omics approaches be integrated to understand napH function in the context of H. influenzae pathogenesis?

Multi-omics integration provides a comprehensive understanding of napH function within H. influenzae pathogenesis. A systematic approach includes:

  • Genomics: Identify napH sequence variations across H. influenzae strains and correlate with virulence phenotypes. Determine if napH is part of the core or accessory genome.

  • Transcriptomics: Analyze napH expression patterns under different conditions, particularly comparing in vitro growth to in vivo infection models. In vivo RNA-seq has already revealed significant differences in metabolic gene expression between these conditions .

  • Proteomics: Quantify napH protein levels and post-translational modifications during infection. Identify interaction partners through co-immunoprecipitation coupled with mass spectrometry.

  • Metabolomics: Measure changes in cellular redox state and energy metabolites in wild-type versus napH mutants to determine metabolic consequences of napH dysfunction.

  • Interactomics: Map protein-protein interactions to place napH within the electron transport network of H. influenzae.

Integration of these datasets requires sophisticated bioinformatic approaches:

  • Network analysis to identify functional modules associated with napH

  • Machine learning algorithms to predict conditions affecting napH function

  • Pathway enrichment analysis to connect napH activity to broader metabolic processes

This multi-layered approach has been successfully used for studying H. influenzae biofilm communities, where the combination of proteome, transcriptome, and metabolome analyses revealed key bacterial metabolic traits .

What computational approaches can predict structural features of napH that influence its electron transfer properties?

Computational prediction of napH structural features that influence electron transfer properties involves multiple bioinformatic approaches:

  • Homology Modeling: Generate structural models based on related ferredoxin-type proteins with known structures. These models provide insights into the spatial arrangement of iron-sulfur clusters and potential electron transfer pathways.

  • Molecular Dynamics Simulations: Simulate the dynamics of napH in a membrane environment to identify conformational changes that might influence electron transfer efficiency.

  • Quantum Mechanical Calculations: Calculate electronic properties of the iron-sulfur clusters to predict redox potentials and electron transfer rates.

  • Protein-Protein Docking: Predict interactions between napH and its electron transfer partners to identify key residues involved in complex formation.

  • Electrostatic Surface Mapping: Calculate the distribution of charges on the protein surface to identify potential interaction sites with electron donors/acceptors.

Implementation of these approaches requires specialized software packages and computational resources. Results should be validated experimentally through site-directed mutagenesis of predicted key residues followed by functional assays measuring electron transfer capabilities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.