Recombinant Haemophilus influenzae Fumarate reductase subunit D (frdD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will do our best to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
frdD; CGSHiEE_07900; Fumarate reductase subunit D; Quinol-fumarate reductase subunit D; QFR subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-114
Protein Length
full length protein
Species
Haemophilus influenzae (strain PittEE)
Target Names
frdD
Target Protein Sequence
MVDQNPKRSGEPPVWLMFGAGGTVSAIFFPVVILIIGLLLPFGLVDAHNLITFAYSWIGK LVILVLTIFPMWCGLHRIHHGMHDLKVHVPAGGFIFYGLATIYTVWVLFAVINL
Uniprot No.

Target Background

Function
Fumarate reductase subunit D (frdD) anchors the catalytic components of the fumarate reductase complex to the cell membrane, facilitating the binding of quinones.
Database Links
Protein Families
FrdD family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Haemophilus influenzae fumarate reductase subunit D and its role in bacterial metabolism?

Fumarate reductase subunit D (frdD) is a membrane-anchoring protein component of the fumarate reductase complex in Haemophilus influenzae. This complex plays a critical role in anaerobic respiration by catalyzing the conversion of fumarate to succinate as part of the bacterial electron transport chain. The complete fumarate reductase enzyme typically consists of four subunits (A-D), with frdD specifically functioning as a hydrophobic membrane anchor that contains transmembrane domains .

In the context of H. influenzae metabolism, frdD allows the bacterium to use fumarate as a terminal electron acceptor under low-oxygen conditions, which is particularly important for this pathogen as it navigates between different microenvironments within the human host that vary in oxygen availability . Metabolic studies have shown that fumarate reductase subunits are expressed under both microaerobic and anaerobic growth conditions, indicating its importance in the adaptive metabolism of this organism .

How can recombinant frdD be expressed and purified for research purposes?

The expression and purification of recombinant Haemophilus influenzae frdD requires specialized approaches due to its membrane protein nature. Recommended protocols include:

  • Expression System Selection: Use E. coli strains optimized for membrane protein expression (such as C41(DE3) or C43(DE3)) with expression vectors containing inducible promoters (T7 or tac).

  • Induction Conditions: Lower temperatures (16-20°C) and reduced inducer concentrations often improve the folding of membrane proteins. For frdD, expression at 18°C with 0.1-0.5 mM IPTG for 16-20 hours has proven effective in similar membrane proteins.

  • Membrane Extraction: Following cell lysis, membrane fractions should be isolated through differential centrifugation. The membrane fraction containing frdD can then be solubilized using detergents such as n-dodecyl β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) at concentrations just above their critical micelle concentration.

  • Purification Strategy: If the recombinant protein contains an affinity tag, immobilized metal affinity chromatography (IMAC) can be used as an initial purification step, followed by size exclusion chromatography to obtain the pure protein-detergent complex .

Similar approaches have been successfully employed for other H. influenzae membrane proteins, such as those involved in iron uptake systems .

What are the optimal storage conditions for maintaining frdD stability?

Recombinant frdD should be stored in conditions that maintain its structural integrity and prevent degradation. Based on available information for this specific protein, the following storage conditions are recommended:

  • Short-term storage (up to one week): 4°C in a Tris-based buffer containing 50% glycerol optimized for protein stability .

  • Long-term storage: -20°C or -80°C in single-use aliquots to avoid repeated freeze-thaw cycles, which can lead to protein denaturation and aggregation .

  • Buffer composition: A Tris-based buffer system (typically 20-50 mM, pH 7.5-8.0) containing 50% glycerol and potentially additional stabilizing agents such as 100-150 mM NaCl and 0.5-1 mM DTT to maintain reducing conditions may be optimal .

It is crucial to avoid repeated freeze-thaw cycles as these can significantly reduce protein activity and stability . For experimental work requiring multiple uses, preparing small working aliquots stored at 4°C for up to one week is recommended.

How is frdD expression regulated in response to environmental conditions?

The expression of frdD in Haemophilus influenzae appears to be primarily regulated by oxygen availability and is part of the complex regulatory networks that control anaerobic metabolism. Key regulatory mechanisms include:

  • ArcAB Two-Component System: Research on H. influenzae has demonstrated that the ArcAB system, which senses respiratory conditions, regulates genes involved in the respiratory chain. Deletion of arcA resulted in increased anaerobic expression of respiratory chain components, suggesting that ArcA typically represses these genes under anaerobic conditions . While specific data on frdD regulation by ArcA is not explicitly provided in the search results, the pattern observed in other respiratory chain components suggests frdD may be similarly regulated.

  • Fur Regulation: The Ferric Uptake Regulator (Fur) is known to influence gene expression patterns in H. influenzae in response to iron availability . Since iron is an essential component of many respiratory enzymes, including fumarate reductase, there may be cross-talk between iron availability sensing and respiratory metabolism regulation.

  • Growth Phase-Dependent Expression: Metabolic studies have shown that the expression of fumarate reductase subunits can vary depending on the growth phase and metabolic needs of the bacterium. In silico metabolic models have been used to predict expression patterns under different growth conditions .

Current research indicates that subunits of fumarate reductase are detected under both microaerobic and anaerobic growth conditions in H. influenzae, suggesting a complex regulatory pattern that allows the bacterium to adapt to fluctuating oxygen levels in its environment .

What is the relationship between frdD and other components of the electron transport chain in H. influenzae?

The fumarate reductase complex, of which frdD is a component, plays a crucial role in the electron transport chain of H. influenzae, particularly under anaerobic conditions. The relationships between frdD and other components include:

  • Integration with Anaerobic Respiration: Fumarate reductase serves as a terminal electron acceptor complex during anaerobic respiration, accepting electrons from menaquinol and transferring them to fumarate, which is reduced to succinate. This process generates a proton motive force that drives ATP synthesis .

  • Relationship with Dehydrogenases: Fumarate reductase works in concert with various dehydrogenases in H. influenzae, including D(-)-lactate dehydrogenase, which has been purified and characterized as a tetramer of Mr 135,000 . These dehydrogenases provide electrons to the quinone pool, which are then utilized by fumarate reductase during anaerobic respiration.

  • Partial TCA Cycle Operation: H. influenzae possesses a partial tricarboxylic acid (TCA) cycle. Under anaerobic conditions, the fumarate reductase complex effectively reverses the reaction catalyzed by succinate dehydrogenase in the aerobic TCA cycle, allowing the bacterium to maintain redox balance and generate energy .

  • Membrane Localization: As a membrane anchor protein, frdD ensures that the fumarate reductase complex is properly positioned in the cell membrane, facilitating efficient electron transfer between the quinone pool and the catalytic subunits of the complex .

This integrated system allows H. influenzae to adapt its energy generation mechanisms based on available electron acceptors, which is critical for its survival in different host microenvironments with varying oxygen levels .

How does frdD contribute to H. influenzae pathogenesis and virulence?

While the direct contribution of frdD to Haemophilus influenzae pathogenesis is not explicitly detailed in the search results, its role can be inferred from understanding the importance of anaerobic metabolism in pathogenesis:

  • Adaptation to Low-Oxygen Environments: H. influenzae is known to transit between niches within the human host that differ in oxygen levels . As a component of fumarate reductase, frdD enables the bacterium to respire anaerobically in low-oxygen environments such as the middle ear during otitis media, the sinuses during sinusitis, and in biofilms within the respiratory tract .

  • Metabolic Flexibility: The ability to utilize alternative electron acceptors like fumarate through the fumarate reductase complex provides H. influenzae with metabolic flexibility to persist in challenging host environments. This adaptation is particularly important for a bacterium that causes chronic infections and has no identified natural niche outside the human host .

  • Potential Connection to Oxidative Stress Response: Research has shown that the ArcA regulon, which likely influences fumarate reductase expression, is involved in resistance to oxidative stress in H. influenzae. Deletion of arcA resulted in increased susceptibility to hydrogen peroxide, particularly following anaerobic growth . This suggests that the anaerobic respiratory apparatus, which includes fumarate reductase, may contribute to the bacterium's ability to transition between anaerobic environments and those with oxidative stress.

  • Association with Chronic Respiratory Diseases: H. influenzae is a major cause of otitis media, sinusitis, and exacerbations of chronic obstructive pulmonary disease . The metabolic adaptations enabled by systems like fumarate reductase likely contribute to the bacterium's persistence in these disease states.

What experimental approaches can be used to study frdD function in pathogenesis models?

To investigate the role of frdD in H. influenzae pathogenesis, researchers can employ several experimental approaches:

These approaches would provide comprehensive insights into how frdD contributes to H. influenzae pathogenesis across different infection stages and host environments.

How can recombinant frdD be used in structural and functional studies?

Recombinant Haemophilus influenzae frdD can be leveraged for various structural and functional studies to enhance understanding of its role and properties:

  • Structural Biology Applications:

    • X-ray crystallography of the purified protein (potentially in complex with other fumarate reductase subunits) to determine atomic-level structure.

    • Cryo-electron microscopy to visualize the intact fumarate reductase complex in a near-native state.

    • NMR spectroscopy for dynamic structural information, particularly regarding membrane interactions.

    • Molecular dynamics simulations based on experimental structures to understand protein movement and interactions.

  • Functional Characterization:

    • Reconstitution of frdD with other fumarate reductase subunits in proteoliposomes to study the functional complex.

    • Site-directed mutagenesis of key residues to identify those critical for membrane anchoring and interaction with other subunits.

    • Analysis of protein-protein interactions between frdD and other components of the fumarate reductase complex using techniques such as pull-down assays, surface plasmon resonance, or bacterial two-hybrid systems.

  • Biophysical Characterization:

    • Circular dichroism spectroscopy to assess secondary structure content and thermal stability.

    • Fluorescence spectroscopy to study protein folding and ligand binding properties.

    • Analytical ultracentrifugation to determine oligomeric state and potential detergent binding.

  • Antibody Generation and Immunological Studies:

    • Development of specific antibodies against frdD for localization studies.

    • Immunoprecipitation experiments to identify interaction partners in vivo.

    • Immunofluorescence microscopy to visualize the distribution of frdD in bacterial cells under different growth conditions.

The recombinant protein product described in the search results, available in 50 μg quantities with specific storage conditions, would be suitable for many of these applications .

What are the current challenges and limitations in studying H. influenzae frdD?

Researchers studying Haemophilus influenzae frdD face several key challenges and limitations:

  • Membrane Protein Challenges:

    • Expression and purification difficulties due to the hydrophobic nature of frdD.

    • Maintaining proper folding and stability during purification and subsequent experiments.

    • Obtaining sufficient quantities of functional protein for structural studies.

    • Finding appropriate detergents that maintain native structure while allowing experimental manipulation.

  • Functional Assessment Complexities:

    • The need to reconstitute the complete fumarate reductase complex (frdABCD) to study authentic function.

    • Challenges in measuring enzymatic activity due to the requirement for membrane integration.

    • Difficulties in separating the specific contribution of frdD from other subunits in functional assays.

  • In Vivo Relevance:

    • Connecting in vitro findings to in vivo function, particularly in the context of host-pathogen interactions.

    • Limited availability of appropriate animal models that accurately reflect human H. influenzae infections.

    • Challenges in monitoring frdD expression and function during infection due to low bacterial numbers and host tissue interference.

  • Regulatory Network Complexity:

    • Incomplete understanding of the regulatory networks controlling frdD expression in different host environments.

    • Potential overlapping or redundant functions with other respiratory components.

    • Complex interplay between oxygen sensing, iron regulation, and metabolic control systems that influence frdD expression .

  • Technical Limitations:

    • Genetic manipulation challenges in some clinical isolates of H. influenzae.

    • Difficulties in differentiating between direct and indirect effects when studying global regulators that affect frdD expression.

    • Limited commercial availability of specific tools and reagents for studying H. influenzae metabolism compared to model organisms like E. coli.

Addressing these challenges requires interdisciplinary approaches combining molecular biology, biochemistry, structural biology, and infection models to fully understand the role of frdD in H. influenzae physiology and pathogenesis .

How does H. influenzae frdD compare to homologous proteins in other bacterial pathogens?

Comparative analysis reveals important similarities and differences between Haemophilus influenzae frdD and its homologs in other bacterial species:

  • Structural Conservation:

    • The frdD protein from H. influenzae shares basic structural features with homologs in other bacteria, particularly the presence of transmembrane domains that anchor the fumarate reductase complex to the membrane.

    • The 114-amino acid length of H. influenzae frdD is similar to homologous proteins in related species, suggesting conserved functional requirements .

  • Functional Comparison:

    • While detailed comparative functional studies are not provided in the search results, the role of fumarate reductase in anaerobic respiration appears to be conserved across many bacterial species that inhabit low-oxygen environments.

    • The integration of fumarate reductase into respiratory chains that allow adaptation to varying oxygen levels seems to be a common feature among facultative anaerobes that colonize human hosts.

  • Regulatory Differences:

    • The regulation of fumarate reductase differs between bacterial species. In H. influenzae, the ArcAB two-component system influences the expression of respiratory chain components, which likely includes fumarate reductase .

    • This regulatory pattern may differ from other pathogens, reflecting adaptation to different ecological niches and host environments.

  • Pathogenesis Contribution:

    • The contribution of fumarate reductase to pathogenesis varies among bacterial species. In H. influenzae, which causes primarily respiratory infections, the ability to respire under low-oxygen conditions in the respiratory tract is particularly important .

    • This may contrast with enteric pathogens, where fumarate reductase might be more important for survival in the anaerobic gut environment.

A comprehensive understanding of these differences could potentially inform targeted antimicrobial strategies that exploit unique features of H. influenzae frdD or its regulation.

What insights can metabolic modeling provide about frdD function in the broader context of H. influenzae metabolism?

In silico metabolic modeling offers valuable insights into the role of frdD within the broader metabolic network of Haemophilus influenzae:

Combined with experimental protein expression data, these modeling approaches provide a comprehensive view of H. influenzae metabolism that cannot be achieved through either method alone .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.