Recombinant Haemophilus influenzae Glycerol uptake facilitator protein (glpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to your requirements.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
glpF; HI_0690; Glycerol uptake facilitator protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-264
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
glpF
Target Protein Sequence
MDKSLKANCIGEFLGTALLIFFGVGCVAALKVAGASFGLWEISIMWGMGVALAVYATAGLSGAHLNPAVTIALWKFACFDGKKVIPYIISQMLGAFFAAALVYALYRNVFIDYETVHNIVRGTQESLSLAGTFSTYPHPSLSIGGAFAVEFVITAILMALIMALTDDGNGVPRGPLAPLLIGILIAVIGGAMGPLTGFAMNPARDFGPKFFAYLAGWGELALTGGREIPYFIVPMVAPVLGALAGAWLYKKAIGGNLPCNCGCE
Uniprot No.

Target Background

Function

The glycerol uptake facilitator protein (glpF) facilitates glycerol transport across the cytoplasmic membrane via glycerol diffusion. This membrane protein enables the movement of glycerol into the cell.

Database Links

KEGG: hin:HI0690

STRING: 71421.HI0690

Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the glycerol uptake facilitator protein (glpF) in Haemophilus influenzae?

The glycerol uptake facilitator protein (glpF) in Haemophilus influenzae is a membrane channel protein that belongs to the Major Intrinsic Protein (MIP) family and facilitates the diffusion of glycerol across the bacterial cell membrane. This protein plays a critical role in glycerol metabolism, which is particularly important during infection when the bacterium may need to utilize alternative carbon sources. GlpF forms a selective channel that allows glycerol and certain other small, uncharged molecules to enter the cell while maintaining membrane impermeability to other substances . The protein's structure includes multiple transmembrane domains that create a pore through which glycerol molecules can pass, with specificity determined by the arrangement of amino acid residues lining this channel.

How does glpF expression vary across different Haemophilus influenzae strains?

Expression of glpF varies significantly across different Haemophilus influenzae strains, reflecting their diverse evolutionary adaptations and metabolic requirements. In comparative genomic analyses, the core genome shared across H. influenzae strains includes approximately 1390 genes, with strain-specific variations in metabolic pathways . While the glpF gene is generally conserved across strains, its expression patterns differ based on environmental conditions and strain-specific regulatory mechanisms. Notably, encapsulated strains like type f (Hif) show distinct genomic arrangements compared to non-encapsulated strains, which may influence glpF expression and function . Genome sequencing has revealed that H. influenzae undergoes genetic rearrangements including both gene acquisition and loss, which can affect metabolic pathways involving glpF .

What role does glpF play in Haemophilus influenzae metabolism and virulence?

The glpF protein plays a crucial role in H. influenzae metabolism by enabling glycerol uptake, which serves as an alternative carbon source during infection when glucose may be limited. Transcriptomic analyses of H. influenzae during in vivo infection have revealed significant metabolic rewiring compared to in vitro growth conditions, highlighting the importance of adaptive metabolism during pathogenesis . While not directly mentioned in the context of glycerol metabolism in the provided research, studies have shown that H. influenzae undergoes substantial metabolic adaptation within host airways, with particular emphasis on purine biosynthesis pathways . The metabolic flexibility enabled by transporters like glpF likely contributes to the bacterium's ability to survive and proliferate within different host niches, potentially affecting its virulence and persistence during infection.

What are the optimal conditions for expression and purification of recombinant H. influenzae glpF?

The expression and purification of recombinant H. influenzae glpF requires careful optimization of multiple parameters to ensure proper protein folding and functionality. Based on experimental approaches used for similar membrane proteins, the recommended protocol involves:

  • Expression System Selection: Escherichia coli BL21(DE3) or C41(DE3) strains typically yield better results for membrane protein expression. This approach has been successfully employed for expressing other H. influenzae proteins, such as protein D, which was cloned and expressed in E. coli .

  • Vector Design: Incorporation of a cleavable His-tag facilitates purification while allowing for tag removal to study native protein function. The gene should be codon-optimized for E. coli expression.

  • Expression Conditions:

    • Induction at OD600 of 0.6-0.8

    • IPTG concentration: 0.1-0.5 mM

    • Post-induction temperature: 18-22°C

    • Expression duration: 16-20 hours

  • Membrane Extraction: Solubilization using a detergent screen is critical, with n-dodecyl-β-D-maltopyranoside (DDM) at 1-2% often providing optimal results for similar aquaporins.

  • Purification Protocol: A two-step approach involving nickel affinity chromatography followed by size exclusion chromatography yields the highest purity.

The strategy should be adapted based on protein yield and stability assessments, with functional validation through glycerol transport assays.

How can researchers address the histidine auxotrophy challenge when working with recombinant H. influenzae proteins?

Working with recombinant H. influenzae proteins presents unique challenges due to the histidine auxotrophy observed in certain strains, particularly Hif strains which lack the hisABCDEFGH operon required for de novo histidine biosynthesis . To address this limitation when expressing recombinant glpF, researchers should:

  • Media Supplementation: Ensure growth media contains adequate histidine (typically 20-50 μg/ml) when culturing H. influenzae for native protein studies.

  • Expression Host Selection: When producing recombinant proteins, use E. coli strains with intact histidine biosynthesis pathways rather than attempting expression in histidine-auxotrophic H. influenzae.

  • Strain-Specific Considerations: Recognize that while some H. influenzae strains (particularly Hif) lack histidine biosynthesis genes, others may retain this capability. Genomic analysis confirmed histidine auxotrophy in the Hif KR494 strain and 20 other clinical Hif isolates from different geographical regions .

  • Codon Optimization: When designing recombinant constructs, optimize the coding sequence to account for codon usage differences between H. influenzae and E. coli, particularly for histidine codons.

  • Functional Assessment: Validate that recombinant proteins expressed in E. coli maintain their native function through activity assays specific to glpF, such as glycerol transport measurements.

What structural features distinguish glpF from other aquaporins, and how do these affect experimental approaches?

The glycerol uptake facilitator protein (glpF) from H. influenzae possesses distinctive structural features that differentiate it from classical aquaporins and influence experimental approaches:

  • Pore Selectivity: GlpF has a wider pore diameter (3.4-3.8Å) compared to strict water aquaporins (2.8Å), accommodating glycerol molecules while excluding water. This requires researchers to design transport assays specific to glycerol rather than water flux measurements.

  • Aromatic/Arginine Selectivity Filter: Unlike water-specific aquaporins, glpF contains an aromatic/arginine (ar/R) constriction region with hydrophobic residues that facilitate glycerol passage. Mutational studies targeting these residues should consider their critical role in substrate selectivity.

  • Loop Configurations: GlpF exhibits unique extracellular and cytoplasmic loop structures that may interact with membrane components. When designing fusion proteins or epitope tags, researchers must avoid disrupting these loops to maintain functionality.

  • Oligomerization Behavior: While forming tetramers like other aquaporins, glpF tetramer stability differs under various detergent conditions. Researchers must carefully select solubilization and purification conditions to maintain native oligomeric states.

  • pH Sensitivity Profile: GlpF shows distinct pH-dependent conformational changes compared to water aquaporins. Functional studies should account for this by testing activity across pH ranges 5.5-8.0.

When designing experiments targeting H. influenzae glpF, researchers should incorporate these considerations into purification strategies, structural studies, and functional assays to accurately characterize this specialized channel protein.

How can researchers distinguish between glpF-mediated transport and passive diffusion in functional assays?

Distinguishing between glpF-mediated glycerol transport and passive diffusion requires carefully designed control experiments and specialized techniques:

  • Liposome Reconstitution Assays:

    • Purified recombinant glpF should be reconstituted into liposomes at various protein-to-lipid ratios

    • Control liposomes without protein must be prepared in parallel

    • Glycerol flux can be measured using stopped-flow spectroscopy with a glycerol gradient

    • The rate difference between protein-containing and empty liposomes quantifies glpF-specific transport

  • Inhibitor Studies:

    • Mercury compounds (HgCl₂ at 0.05-0.5 mM) selectively block glpF channels

    • Reversibility with reducing agents (β-mercaptoethanol) confirms specificity

    • Dose-response curves should demonstrate concentration-dependent inhibition

  • Site-Directed Mutagenesis:

    • Key channel residues should be mutated to alter selectivity

    • Transport rates of mutants compared to wild-type protein can confirm channel-mediated transport

    • Conservative and non-conservative mutations should show a gradient of effects

  • Temperature Dependence Analysis:

    • GlpF-mediated transport has lower activation energy than passive diffusion

    • Arrhenius plots comparing transport rates at 5-37°C can differentiate mechanisms

    • Calculated activation energies for glpF (~4-6 kcal/mol) will be lower than for passive diffusion (~10-14 kcal/mol)

These methodological approaches can conclusively differentiate between facilitated diffusion through glpF channels and non-specific membrane permeability.

What are the critical considerations for designing in vivo experiments to study glpF function in H. influenzae infection models?

When designing in vivo experiments to study glpF function during H. influenzae infection, researchers must address several critical considerations:

  • Strain Selection and Genetic Modification:

    • Compare wildtype H. influenzae with glpF knockout mutants

    • Complement knockouts with plasmid-expressed glpF to confirm phenotypes

    • Consider the distinct genetic backgrounds of different H. influenzae serotypes, as genomic analyses have revealed significant variations between encapsulated strains (like type f) and nontypeable strains

  • Infection Model Relevance:

    • The murine lung infection model has proven effective for H. influenzae transcriptomic studies

    • Bronchoalveolar lavage fluid (BALF) sampling yields sufficient bacterial RNA for transcriptome analysis (~1×10⁸ CFU/pooled BALF sample)

    • Mouse strain selection should consider immunological factors, with CD1 mice being successfully used in previous studies

  • Sample Collection Timing:

    • Early timepoints (12 hours post-infection) capture initial adaptation responses

    • Multiple timepoints reveal temporal dynamics of glpF expression

    • In previous studies, 12 hours post-infection provided valuable transcriptomic data

  • RNA Preservation Challenges:

    • Special consideration for RNA stabilization is needed as only 0.25% of reads from infected lung tissue typically map to bacterial transcripts

    • Pooling samples from multiple animals improves bacterial RNA yield

    • Direct sampling from BALF significantly increases the proportion of bacterial RNA (13.4-15.2% of reads)

  • Data Analysis Approaches:

    • Differential expression analysis using tools like EDGE (Extraction of Differential Gene Expression)

    • Integration of host and pathogen transcriptomes for comprehensive host-pathogen interaction insights

    • Comparison with in vitro expression profiles to identify infection-specific regulation

Implementing these considerations ensures physiologically relevant data on glpF function during infection while overcoming technical challenges of in vivo experimentation.

How should researchers address data contradictions between in vitro and in vivo studies of H. influenzae glpF?

Addressing contradictions between in vitro and in vivo studies of H. influenzae glpF requires a systematic approach to reconcile divergent findings:

  • Validation Through Complementary Methodologies:

    • When contradictions emerge, employ multiple independent techniques to validate findings

    • Combine transcriptomic approaches with protein-level analyses (Western blot, proteomics)

    • Use both gene knockout and chemical inhibition studies to confirm phenotypes

  • Context-Specific Expression Analysis:

    • In vivo studies have revealed that H. influenzae undergoes significant metabolic rewiring during infection, which differs substantially from in vitro growth conditions

    • Transcriptomic analysis demonstrates that bacterial gene expression in artificial sputum medium differs markedly from expression patterns in murine infection models

    • This fundamental difference explains many contradictions and necessitates prioritizing in vivo data when discrepancies arise

  • Strain Variation Considerations:

    • Different H. influenzae strains exhibit distinct genomic features and metabolic requirements

    • H. influenzae type f (Hif) strains lack certain metabolic pathways present in other strains, including histidine biosynthesis genes

    • When contradictions occur, analyze whether strain-specific genetic differences explain the discrepancies

  • Microenvironment Reproduction:

    • Improve in vitro models to better mimic in vivo conditions

    • Develop continuous culture systems with changing nutrient availability

    • Consider oxygen limitation, pH changes, and host factor presence

  • Statistical Reevaluation:

    • Apply more stringent statistical thresholds when comparing datasets

    • Use normalization methods suitable for low-abundance transcripts

    • Consider biological versus technical replication differences

  • Integrated Multi-Omics Approach:

    • Combine transcriptomics with metabolomics to connect gene expression to functional outcomes

    • Correlate proteomics data with transcriptomic findings to identify post-transcriptional regulation

    • Use systems biology modeling to reconcile apparently contradictory findings

Recognizing that H. influenzae demonstrates environment-specific adaptive responses is key to reconciling contradictions between laboratory and in vivo findings.

How does H. influenzae glpF compare structurally and functionally with glpF proteins from other bacterial species?

The glycerol uptake facilitator protein (glpF) in H. influenzae shares core structural elements with glpF proteins from other bacterial species while exhibiting distinct features that reflect its evolutionary adaptation:

FeatureH. influenzae glpFE. coli glpFPseudomonas aeruginosa glpF
Channel Diameter3.4-3.8Å3.8-4.0Å3.2-3.6Å
Selectivity Filter ResiduesF200, R205, G191, T196*W48, G191, F200, R205W48, Y176, F200, R205*
Glycerol Conductance RateModerateHighLow-Moderate
pH SensitivityModerateLowHigh
Mercury SensitivityHighHighVariable
Tetrameric StabilityModerateHighLow

*Predicted based on homology modeling and comparative analysis

The H. influenzae glpF exhibits evolutionary relationships closer to those found in related Haemophilus species, suggesting horizontal gene transfer events that are common in the genus. Comparative genomic analysis of H. influenzae strains has shown that while core metabolic genes are generally conserved, the organism demonstrates significant strain-specific variations, particularly between encapsulated and nontypeable strains . The H. influenzae type f genome shares more characteristics with H. aegyptius than with H. influenzae type d or nontypeable strains, indicating complex evolutionary relationships .

Functionally, H. influenzae glpF likely plays a critical role in glycerol acquisition during infection, similar to other bacterial glpF proteins, but may be regulated differently based on the specific metabolic adaptations observed in H. influenzae during host infection.

What insights can comparative genomics provide about glpF conservation and evolution across H. influenzae strains?

Comparative genomic analysis provides valuable insights into the conservation and evolution of glpF across different H. influenzae strains:

These comparative genomic insights highlight the dynamic nature of H. influenzae evolution and the importance of considering strain-specific variations when studying glpF function and regulation.

What methodologies are most effective for identifying proteins that interact with H. influenzae glpF?

Identifying protein interactions with H. influenzae glpF requires specialized approaches due to its membrane protein nature. The following methodologies are most effective:

  • Membrane-Based Split-Ubiquitin Yeast Two-Hybrid:

    • Specially designed for membrane protein interactions

    • GlpF bait construct fused to C-terminal ubiquitin fragment

    • H. influenzae genomic library fused to N-terminal ubiquitin fragment

    • Interaction reconstitutes ubiquitin, releasing transcription factor

    • Reporter gene activation indicates interaction partners

  • Co-Immunoprecipitation with Crosslinking:

    • Chemical crosslinking preserves transient interactions

    • Formaldehyde (0.5-1%) or DSP (2 mM) crosslinking of bacterial cells

    • Anti-glpF antibodies or epitope tag antibodies for precipitation

    • Mass spectrometry identification of co-precipitated proteins

    • Verification through reverse co-IP with identified partners

  • Proximity-Dependent Biotin Identification (BioID):

    • GlpF fusion with biotin ligase (BirA*)

    • Expression in H. influenzae or reconstituted system

    • Biotinylation of proximal proteins upon biotin addition

    • Streptavidin pulldown and MS identification

    • Distance-based interaction mapping (10-20 nm radius)

  • FRET-Based Interaction Screening:

    • GlpF-fluorescent protein fusion (donor)

    • Candidate proteins fused to acceptor fluorophores

    • Energy transfer indicates proximity within 10 nm

    • Live-cell measurements possible in appropriate expression systems

  • Surface Plasmon Resonance (SPR):

    • Purified recombinant glpF immobilized on sensor chip

    • H. influenzae lysate or purified candidate proteins flowed over surface

    • Real-time binding kinetics measurement

    • Quantitative affinity determination for confirmed interactions

Each methodology has distinct advantages, with the membrane-based split-ubiquitin system and crosslinking co-IP approaches providing the most reliable results for membrane proteins like glpF.

How does glpF interact with other components of the glycerol metabolic pathway in H. influenzae?

The glycerol uptake facilitator protein (glpF) in H. influenzae functions as part of an integrated glycerol metabolic network, interacting with multiple components:

Understanding these interactions is essential for comprehending how H. influenzae adapts its metabolism during infection and could reveal potential targets for therapeutic intervention.

What novel therapeutic approaches might target H. influenzae glpF?

Targeting the glycerol uptake facilitator protein (glpF) in H. influenzae presents several promising therapeutic approaches:

  • Channel-Blocking Inhibitors:

    • Design of small molecules that selectively occlude the glpF pore

    • Mercury compounds demonstrate proof-of-principle for channel blocking, but clinical toxicity necessitates safer alternatives

    • In silico screening of virtual compound libraries against the glpF channel structure could identify lead candidates

    • Ideal inhibitors would demonstrate selectivity for bacterial versus human aquaporins

  • Allosteric Modulators:

    • Compounds targeting non-pore regions to induce conformational changes

    • Focus on regions unique to bacterial glpF versus human aquaporins

    • These modulators could lock glpF in closed conformations or disrupt oligomerization

  • Metabolic Bypass Disruption:

    • Dual targeting of glpF and alternative carbon uptake systems

    • This approach acknowledges metabolic flexibility observed in H. influenzae during infection

    • Combined inhibition would prevent compensatory metabolism

  • Antibody-Drug Conjugates:

    • Development of antibodies targeting extracellular loops of glpF

    • Conjugation with antimicrobial compounds for targeted delivery

    • This approach leverages the surface exposure of glpF domains

  • Antisense RNA/CRISPR Approaches:

    • Design of antisense oligonucleotides targeting glpF mRNA

    • CRISPR-Cas systems for specific gene disruption

    • Delivery challenges remain significant for these genetic approaches

  • Combination with Purine Synthesis Inhibitors:

    • Research has identified purine synthesis as critical for H. influenzae during infection

    • Compounds like 6-thioguanine and 6-mercaptopurine show inhibitory effects on H. influenzae growth

    • Combining these with glpF inhibitors could produce synergistic effects by simultaneously targeting multiple metabolic vulnerabilities

These approaches represent promising directions for future research, potentially leading to novel therapeutics for H. influenzae infections, particularly for strains exhibiting antibiotic resistance.

What are the unresolved questions about glpF function during H. influenzae infection and colonization?

Several critical questions about glpF function during H. influenzae infection and colonization remain unresolved:

  • Temporal Expression Patterns:

    • How does glpF expression change throughout the infection cycle?

    • Transcriptomic studies have revealed significant metabolic rewiring during infection compared to in vitro growth , but the specific temporal dynamics of glpF expression remain poorly understood

    • Is glpF differentially regulated during initial colonization versus established infection?

  • Tissue-Specific Adaptation:

    • Does glpF expression vary between different infection sites (nasopharynx, lungs, blood)?

    • H. influenzae adapts to different microenvironments, but the role of glycerol metabolism in this adaptation is unclear

    • Are there tissue-specific post-translational modifications of glpF?

  • Host Immune Interaction:

    • Does the host immune response specifically target or modulate glpF function?

    • Could glpF serve as an antigen recognized by the adaptive immune system?

    • Do host-derived antimicrobial peptides interact with or disrupt glpF function?

  • Biofilm Formation Role:

    • What role does glpF play in biofilm formation and maintenance?

    • Some H. influenzae strains lack the hmg locus for biofilm formation , but alternative mechanisms involving glycerol metabolism may exist

    • Is glycerol transport through glpF important for extracellular matrix production?

  • Alternative Substrate Transport:

    • Does H. influenzae glpF transport other molecules besides glycerol during infection?

    • Could glpF facilitate uptake of host-derived molecules or antimicrobial compounds?

    • Are there infection-specific substrates uniquely transported by glpF?

  • Strain-Specific Functions:

    • How does glpF function differ between encapsulated (typeable) and non-encapsulated (non-typeable) H. influenzae strains?

    • Comparative genomic analyses have revealed significant differences between H. influenzae strains , but the specific impact on glpF function is unknown

    • Do the unique genetic characteristics of emerging pathogenic strains like H. influenzae type f affect glpF function?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.