Recombinant Haemophilus influenzae Heme exporter protein B (ccmB)

Shipped with Ice Packs
In Stock

Description

Functional Role in Heme Transport

CcmB facilitates heme export from the cytoplasmic membrane to the periplasm, a critical step in cytochrome c maturation (CCM) . Key mechanisms include:

  • Heme Efflux: Overexpression disrupts CCM by depleting intracellular heme .

  • Complexation with CcmACD: Ensures heme is directed exclusively to CCM rather than other pathways .

  • Conserved Activity: Functional homologs exist in α-, β-, and γ-proteobacteria (e.g., E. coli, Pseudomonas aeruginosa) .

Recombinant Production and Expression

ParameterDetails
Expression SystemE. coli
TagsN-terminal 10xHis , variable tags based on stability
Purity>85% (SDS-PAGE)
Storage-20°C (short-term), -80°C (long-term); avoid freeze-thaw cycles

Sequence Highlights

  • Full-length sequences from H. influenzae strains include conserved motifs (e.g., MIFLEIIKRELQ...) and transmembrane domains .

Mechanistic Studies

  • Heme Translocation Pathway: CcmB extracts heme from the membrane via a hydrophobic pocket, with residues L181 and T145 critical for stability .

  • Mutational Analysis: Variants D18A and K79A retain CCM activity but lose heme-efflux capability, confirming functional duality .

Comparative Analysis

OrganismCcmB FunctionalityKey Difference
Shewanella oneidensisHigh efficiencyOptimal heme export
E. coliModerate efficiencyLower heme affinity
Wolbachia phage WONon-functionalEvolutionary divergence

Industrial and Clinical Relevance

  • Vaccine Development: Recombinant ccmB is used to study bacterial virulence, though direct vaccine applications remain exploratory .

  • Antimicrobial Targets: Inhibiting ccmB could disrupt heme metabolism in multidrug-resistant H. influenzae .

Challenges and Future Directions

  • Stability Issues: Shelf life varies with storage conditions (6–12 months) .

  • Structural Dynamics: MD simulations needed to map heme entry pathways .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
ccmB; HI_1090; Heme exporter protein B; Cytochrome c-type biogenesis protein CcmB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-221
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
ccmB
Target Protein Sequence
MIFLEIIKRELQIAMRKNAEILNPLWFFLLVITLFPLVIGPDPKLLSRIAPGIAWVAALL SALLSFERLFRDDFIDGSLEQLMLTAQPLPMTALAKVVAHWLLTGLPLILLSPIAALLLS LEVNIWWALVLTLLLGTPVLSCIGAIGVALTVGLRKGGVLLSLLVVPLFIPVLIFASSVL EAAGLNVPYGGQLAILGAMMVGAVTLSPFAIAAALRISLDN
Uniprot No.

Target Background

Function
This protein plays a crucial role in the export of heme to the periplasm, which is essential for the biogenesis of c-type cytochromes.
Database Links

KEGG: hin:HI1090

STRING: 71421.HI1090

Protein Families
CcmB/CycW/HelB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of ccmB in Haemophilus influenzae?

ccmB (cytochrome c maturation B) serves as a critical heme exporter protein in H. influenzae, facilitating the translocation of heme across the cytoplasmic membrane as part of the cytochrome c maturation pathway. Unlike HbpA, which functions in heme acquisition and is associated with both inner and outer membranes, ccmB is primarily involved in heme export and is localized to the inner membrane. This protein is essential for cytochrome c biogenesis and subsequent respiratory function, making it crucial for the bacterium's energy metabolism .

How does ccmB relate to other heme transport proteins in H. influenzae?

H. influenzae possesses a sophisticated system for heme utilization that includes both import and export mechanisms. While HbpA serves as a periplasmic heme-binding lipoprotein that facilitates heme uptake from various sources (including hemopexin and albumin complexes), ccmB functions in the opposite direction, exporting heme for cytochrome assembly . These systems are complementary but distinct in their roles, with both being critical for the survival of H. influenzae, which has an absolute growth requirement for heme. The functional relationship between these proteins highlights the complexity of heme metabolism in this pathogen and suggests potential interactions within the heme transport network.

What is the genomic context of the ccmB gene in H. influenzae?

The ccmB gene in H. influenzae is typically part of a conserved operon structure that includes other cytochrome c maturation genes (ccmA, ccmC, ccmD, ccmE, ccmF, ccmG, and ccmH). This genomic organization is consistent with the functional relationship between these proteins in the cytochrome c maturation pathway. Analysis of the H. influenzae genome shows that these genes are subject to purifying selection, as evidenced by the low nucleotide diversity observed in many conserved genes within the species . The preservation of this gene cluster across H. influenzae strains underscores its essential role in cellular respiration and energy production.

How does recombination affect the genetic diversity of ccmB across H. influenzae strains?

Recombination in H. influenzae occurs at exceptionally high rates compared to other bacterial pathogens, with the species showing the fastest decay of linkage disequilibrium among common pathogens . For the ccmB gene, this pervasive recombination has significant implications. As part of the core genome, ccmB likely experiences the negative correlation between recombination frequency and nucleotide diversity observed in H. influenzae (Spearman's r = 0.49, p < 7.15×10^-293) .

This suggests that while recombination events may introduce variants of ccmB across strains, strong purifying selection maintains functional conservation of this essential protein. The recombination patterns may vary between nontypeable H. influenzae (NTHi) strains (which comprise 91.7% of isolates in some populations) and encapsulated strains like serotype b (Hib) , potentially leading to subtle functional differences in ccmB across these lineages.

What structural features of recombinant ccmB are crucial for its heme export function?

Recombinant ccmB possesses several key structural features that are essential for its function in heme export:

  • Transmembrane domains: As an inner membrane protein, ccmB contains multiple transmembrane helices that anchor it within the cytoplasmic membrane

  • ATP-binding cassette (ABC) transporter components: ccmB works in conjunction with ccmA (an ATPase) to provide energy for heme translocation

  • Interaction domains: Specific regions that mediate binding with other components of the cytochrome c maturation system, particularly ccmC and ccmE

These structural elements work together to create a functional heme export channel. Studies of related heme transport proteins like HbpA have demonstrated that specific amino acid residues are essential for heme binding and transport capabilities . Similar critical residues likely exist in ccmB, particularly at regions involved in protein-protein interactions within the Ccm complex or at sites that facilitate the passage of heme molecules through the membrane.

How does selection pressure influence ccmB evolution in clinical isolates of H. influenzae?

H. influenzae populations exhibit evidence of pervasive negative (purifying) selection across the genome, with a substantial proportion of genes showing zero nucleotide diversity . As an essential component of the cytochrome c maturation system, ccmB is likely subject to strong purifying selection to maintain its critical function in heme export.

In clinical settings, particularly in densely populated environments or in the presence of antibiotic pressure, selection may be intensified. Multidrug-resistant (MDR) lineages of H. influenzae have been identified globally, suggesting that genes involved in essential cellular functions (potentially including ccmB) may be conserved while allowing for adaptation in other genomic regions . Any mutations that significantly alter ccmB function would likely be deleterious, given the absolute requirement for functional cytochromes in H. influenzae energy metabolism.

What are the optimal conditions for expressing recombinant H. influenzae ccmB protein?

For optimal expression of recombinant H. influenzae ccmB protein, the following protocol is recommended:

Expression System Selection:

  • E. coli BL21(DE3) or derivatives are preferred hosts due to reduced protease activity

  • pET vector systems with T7 promoter control offer high expression levels

Expression Conditions:

ParameterRecommended SettingNotes
Induction0.5 mM IPTGLower concentrations may improve solubility
Temperature20-25°CReduced temperature minimizes inclusion body formation
Duration16-20 hoursExtended expression time at lower temperature
MediaTerrific BrothEnhanced with 5-10 μM heme precursors
OD600 at induction0.6-0.8Mid-log phase provides optimal balance

Membrane Protein Considerations:
As ccmB is a transmembrane protein, expression optimizations should include:

  • Addition of mild detergents (0.1-0.5% Triton X-100) during cell lysis

  • Consideration of C-terminal tagging to minimize interference with membrane insertion

  • Potential co-expression with chaperone proteins to enhance proper folding

This approach draws on methodologies used for expressing other H. influenzae membrane proteins, while specifically addressing the challenges associated with heme transport proteins1 .

What purification strategies are most effective for recombinant ccmB protein?

Purification of recombinant ccmB presents challenges due to its hydrophobic transmembrane domains. A multi-step purification strategy is recommended:

Initial Membrane Isolation:

  • Cell lysis via French press or sonication in buffer containing protease inhibitors

  • Differential centrifugation to isolate membrane fractions (40,000-100,000 × g)

  • Selective membrane solubilization using detergent screening

Detergent Screening Table:

DetergentWorking ConcentrationAdvantagesLimitations
DDM1-2%Mild, preserves functionLower extraction efficiency
LDAO0.5-1%Effective solubilizationPotential destabilization
Fos-Choline-140.1-0.5%High extraction efficiencyPossible denaturation
Digitonin0.5-1%Native-like environmentCost limitations

Affinity Chromatography:

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA for His-tagged constructs

  • Consider heme-agarose affinity chromatography, similar to methods used for HbpA purification

Secondary Purification:

  • Size exclusion chromatography to separate protein-detergent complexes

  • Ion exchange chromatography as a polishing step

Quality Assessment:

  • Western blot confirmation of ccmB identity

  • Heme binding analysis to verify functional integrity

  • Blue native PAGE to assess oligomeric state

This comprehensive strategy incorporates approaches similar to those successfully employed for other H. influenzae membrane proteins while addressing the specific characteristics of heme transporter proteins .

What functional assays can verify the heme export activity of recombinant ccmB?

Several complementary approaches can be employed to verify the heme export activity of recombinant ccmB:

In Vitro Transport Assays:

  • Reconstitution of purified ccmB into proteoliposomes

  • Loading of fluorescently labeled heme analogs inside vesicles

  • Measurement of heme efflux rates using fluorescence quenching techniques

  • Control experiments with site-directed mutants to confirm specificity

Complementation Studies:

  • Construction of ccmB knockout mutants in H. influenzae (similar to approaches used for hbpA )

  • Transformation with plasmids expressing wild-type or mutant ccmB

  • Assessment of cytochrome c levels and respiratory function

  • Growth experiments under various heme availability conditions

Biochemical Interaction Assays:

Assay TypePurposeKey Parameters
Surface Plasmon ResonanceMeasure binding kinetics with ccmC/ccmEKd, kon, koff values
Pull-down assaysIdentify protein-protein interactionsVerification of Ccm complex assembly
ATPase activityMeasure stimulation of ccmA ATPaseDetermine coupling efficiency
Heme transferTrack heme movement between Ccm componentsSpectroscopic monitoring of heme state

Bioenergetic Measurements:

  • Membrane potential assessment in reconstituted systems

  • ATP consumption during active transport

  • Coupling ratio determination between ATP hydrolysis and heme translocation

These methodologies build upon approaches used to characterize other heme transport proteins in H. influenzae while specifically addressing the heme export function of ccmB .

How can researchers create ccmB mutants to study structure-function relationships?

Creating and analyzing ccmB mutants is essential for understanding structure-function relationships. A comprehensive mutation strategy should include:

Targeted Mutagenesis Approaches:

  • Alanine scanning of predicted transmembrane regions

  • Conservative and non-conservative substitutions at potential heme-interacting residues

  • Deletion analysis of predicted protein-protein interaction domains

  • Creation of chimeric proteins with ccmB homologs from related species

High-throughput Mutagenesis:

  • Random mutagenesis via error-prone PCR

  • Construction of comprehensive mutation libraries

  • Functional selection in ccmB knockout complementation systems

Structural Impact Assessment:

  • Circular dichroism spectroscopy to evaluate secondary structure alterations

  • Limited proteolysis to identify conformational changes

  • Detergent stability assays to assess membrane protein integrity

Functional Analysis of Mutants:

Mutation TypeExpected EffectFunctional Readout
ATP-binding domainDisrupted energy couplingReduced transport without affecting binding
Transmembrane regionsAltered heme passageChanged transport kinetics
Interface with ccmCDisrupted complex formationLoss of complementation ability
Conserved motifsFunctional defectsSpecific step inhibition in cytochrome c assembly

This comprehensive mutagenesis strategy is informed by approaches used to study related transport proteins in H. influenzae and would provide valuable insights into the molecular mechanisms of ccmB function in heme export .

What is the relationship between ccmB function and antibiotic resistance in H. influenzae?

While not directly responsible for antibiotic resistance, ccmB function may indirectly influence susceptibility to antimicrobial agents through several mechanisms:

  • Energy-dependent efflux: Functional cytochromes support proton motive force generation, which drives efflux pumps that export antibiotics

  • Metabolic state influence: Respiratory capacity affects bacterial growth rate, which can alter susceptibility to growth-dependent antibiotics

  • Biofilm formation: Energy metabolism impacts biofilm development, a key factor in antibiotic tolerance

Recent genomic studies have identified multidrug-resistant (MDR) lineages of H. influenzae that are widely disseminated internationally . These MDR lineages likely maintain functional ccmB and other essential genes while acquiring resistance determinants. The table below summarizes the potential relationship between ccmB function and different antibiotic classes:

Antibiotic ClassRelationship to ccmB FunctionPotential Impact
β-lactamsIndirect - cell wall synthesis requires energyReduced susceptibility if energy metabolism is optimized
AminoglycosidesDirect - uptake is energy-dependentSignificant impact due to PMF requirement for uptake
MacrolidesModerate - efflux systems are energy-dependentVariable effect depending on specific resistance mechanisms
FluoroquinolonesIndirect - DNA replication and repairMinimal direct effect
TetracyclinesModerate - efflux is energy-dependentVariable effect depending on resistance mechanism

Future research could explore whether variations in ccmB function across different H. influenzae lineages correlate with differences in antibiotic susceptibility patterns .

How can recombinant ccmB be utilized in vaccine development against H. influenzae?

Recombinant ccmB presents several potential applications in vaccine development against H. influenzae, particularly for addressing non-typeable H. influenzae (NTHi) infections, which constitute the majority of current clinical cases (91.7% in some populations) :

Potential Vaccine Applications:

  • Subunit Vaccine Component:

    • Immunogenic extracellular loops of ccmB could be incorporated into multicomponent vaccines

    • Advantages include targeting a conserved, essential protein under purifying selection

    • Challenge: Limited surface exposure may reduce accessibility to antibodies

  • Diagnostic Applications:

    • Recombinant ccmB could serve as a standard antigen for serological assays

    • Potential for developing strain-typing methods based on ccmB variants

  • Adjuvant Carrier Protein:

    • Fusion of immunogenic epitopes to ccmB fragments could enhance immune recognition

    • Potential for directing immune responses to conserved bacterial features

Considerations for Vaccine Development:

AspectAdvantageChallengePotential Solution
ConservationHigh conservation across strains due to purifying selection Limited antigenic diversity for broad responseCombine with variable antigens
ImmunogenicityEssential protein, likely stable expressionPrimarily membrane-embeddedFocus on exposed loops/domains
ProductionEstablished recombinant expression methodsMembrane protein purification difficultiesDevelop soluble fragment vaccines
Cross-protectionPotential coverage across NTHi strainsMay not address encapsulated strainsCombine with serotype-specific antigens

This approach would complement current Hib vaccination strategies by addressing the predominant NTHi strains that cause significant disease burden worldwide, particularly in settings where MDR lineages have become established .

How do genomic studies inform our understanding of ccmB evolution in clinical settings?

Recent genomic analyses of nearly 10,000 H. influenzae isolates, including samples from the Maela displacement camp in Northwestern Thailand, have provided unprecedented insights into the evolution of core genome components like ccmB . These studies reveal several key findings relevant to ccmB evolution:

  • Extreme recombination rates: H. influenzae shows the fastest decay of linkage disequilibrium among common bacterial pathogens, creating a highly dynamic genomic landscape within which ccmB evolves

  • Purifying selection: Despite high recombination rates, many core genes show low nucleotide diversity, suggesting strong negative selection preserves their function

  • Global dissemination patterns: Analysis of MDR lineages reveals international spread of specific clones, indicating that adaptive variants of core genes can spread globally

This genomic context suggests that ccmB likely undergoes selection to maintain its essential function while potentially adapting to different host environments or antibiotic pressures. Future studies targeting ccmB specifically within these diverse genomic datasets could reveal subtle variations that contribute to strain-specific differences in virulence or metabolism.

What cutting-edge technologies are advancing the study of membrane proteins like ccmB?

Several innovative technologies are transforming research on membrane proteins like ccmB:

Structural Biology Advances:

  • Cryo-electron microscopy (cryo-EM) enabling determination of membrane protein structures without crystallization

  • Integrative structural biology approaches combining multiple data sources

  • Hydrogen-deuterium exchange mass spectrometry for analyzing dynamic protein regions

Functional Characterization Tools:

  • Single-molecule tracking to observe transport processes in real time

  • Nanodiscs and styrene-maleic acid lipid particles (SMALPs) for stable membrane protein reconstitution

  • Microfluidic systems for high-throughput functional assays

Genetic Engineering Innovations:

TechnologyApplication for ccmB ResearchPotential Insights
CRISPR-Cas9Precise genomic editing of H. influenzaeDirect assessment of ccmB mutations in native context
Deep mutational scanningComprehensive functional mappingIdentification of all functional residues
Synthetic biology approachesDesigner cytochrome c maturation systemsEngineering optimized heme transport pathways

Computational Methods:

  • Molecular dynamics simulations of membrane transport processes

  • Machine learning approaches to predict functional effects of mutations

  • Systems biology models of heme utilization networks

These technological advances are particularly relevant for studying ccmB given its membrane localization and essential role in a complex transport system, offering opportunities to overcome traditional challenges in membrane protein research1 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.