Recombinant Haemophilus influenzae Heme exporter protein C, also known as ccmC, is a protein involved in the biogenesis of cytochrome c-type proteins. It plays a crucial role in the transfer of heme to the heme chaperone CcmE, which is essential for the maturation of cytochrome c in bacteria like Haemophilus influenzae and Escherichia coli . This protein is typically expressed in E. coli for research purposes and is often tagged with a His-tag for purification .
Protein Length: The full-length protein consists of 246 amino acids .
Applications: Primarily used in SDS-PAGE for protein analysis .
The ccmC protein is essential for transferring heme to the heme chaperone CcmE, which then attaches the heme to apocytochrome c . This process is crucial for the maturation of cytochrome c, a key component in electron transport chains. In Haemophilus influenzae, efficient heme transfer is vital for maintaining cellular respiration and energy production.
Research on ccmC has highlighted its importance in bacterial physiology, particularly in the context of cytochrome c maturation. Mutagenesis studies have shown that conserved histidines in ccmC are critical for its function in heme transfer . This understanding can inform strategies for manipulating bacterial metabolism and virulence factors.
KEGG: hin:HI1091
STRING: 71421.HI1091
CcmC functions as a critical component in the cytochrome c maturation system (System I) in Haemophilus influenzae and other Gram-negative bacteria. Its primary role is to export heme from its cytoplasmic site of synthesis to the periplasm, where it facilitates cytochrome c assembly. CcmC does not function alone but works within a complex system of proteins that collectively ensure proper heme trafficking and incorporation into cytochromes .
The protein contains multiple transmembrane domains (TMDs) and participates in a process where reduced heme (Fe²⁺) is transported across the cytoplasmic membrane. Importantly, CcmC not only exports heme but also protects it from oxidation, which is crucial because only reduced heme can form the correct covalent bonds with apocytochrome c . This protection mechanism is particularly important because the bacterial periplasm is an oxidizing environment compared to the cytoplasm where heme synthesis occurs.
In some organisms, CcmC is fused with CcsA to form a single protein called CcsBA, which functions as a complete cytochrome c synthetase. This arrangement has been observed in organisms like Helicobacter hepaticus, providing valuable insights into the mechanistic aspects of CcmC function .
Recombinant Haemophilus influenzae ccmC is a full-length protein consisting of 246 amino acids (positions 1-246). The protein's amino acid sequence is:
MWKWLHPYAKPETQYRICGKLSPLFAFLTLVLLGVGIVWGLAFAPADYQQGNSFRIMYVHAPTAIWSMGVYGSMAIAAVVALVWQIKQAHLAMIAMAPIGALFTFLSLVTGAIWGKPMWGTWWVWDARLTAELILFFLYLGILALYSAFSDRNIGAKAAGILCITTVVILPIIHFSVEWWNTLHQGASITKLEKPSIAIPMLVPLILCIFGFLTLYIWLTLVRYRMELLKEDAKRPWVKALAQTLK
For experimental applications, the protein is often produced with an N-terminal His-tag to facilitate purification. When expressed in E. coli, the recombinant protein can be purified to greater than 90% purity as determined by SDS-PAGE .
Based on studies of related proteins like CcsBA, we can infer that ccmC likely contains multiple transmembrane domains. The CcsBA protein, which represents a fusion of CcsB and CcsA (related to CcmC), has been shown to have 10 transmembrane domains . These transmembrane segments are critical for forming a channel through which heme is translocated across the membrane.
Within this structure, specific histidine residues play crucial roles in heme binding and transport. In CcsBA, two conserved histidines in transmembrane domains (TMD3 and TMD8) are essential for heme translocation, while two external histidines form a heme binding domain that protects heme from oxidation .
Expression and purification of recombinant H. influenzae ccmC typically follows a standardized protocol designed to maximize protein yield while maintaining functionality. The recombinant protein is expressed in E. coli expression systems with an N-terminal His-tag to facilitate downstream purification processes .
Expression Protocol:
Transform the expression vector containing the ccmC gene into a suitable E. coli strain.
Culture the transformed bacteria in appropriate media with selection antibiotics.
Induce protein expression (typically using IPTG or similar inducers).
Harvest cells by centrifugation.
Purification Process:
Lyse cells using mechanical or chemical methods.
Solubilize membrane proteins using appropriate detergents (e.g., n-dodecyl β-d-maltoside/DDM).
Perform affinity chromatography using the His-tag.
Assess purity by SDS-PAGE (target purity >90%).
For storage, the purified protein is typically maintained as a lyophilized powder. When reconstituting, it's recommended to use deionized sterile water to reach a concentration of 0.1-1.0 mg/mL. For long-term storage, adding glycerol (5-50% final concentration) and aliquoting for storage at -20°C/-80°C is advisable. Importantly, researchers should avoid repeated freeze-thaw cycles as they can compromise protein integrity .
Similar approaches have been used for the purification of related proteins. For example, CcsBA has been expressed as a functional N-terminal fusion to GST, solubilized in n-dodecyl β-d-maltoside (DDM), and affinity-purified to >95% purity .
Properly folded ccmC protein, particularly when bound to heme, displays characteristic spectroscopic features that can be used to assess protein quality and functionality. These spectral properties primarily derive from the protein's interaction with heme and the specific configuration of the heme iron.
Based on studies of related proteins like CcsBA, we can expect that ccmC with bound heme would exhibit distinct absorption spectra in both reduced and oxidized states. Wild-type CcsBA shows absorption maxima at specific wavelengths that reflect the coordination state of the heme iron. For reduced (Fe²⁺) heme, a Soret band maximum is typically observed, along with characteristic α and β bands in the visible region of the spectrum .
When mutations are introduced in critical histidine residues that serve as axial ligands to the heme iron, dramatic changes in these spectral features occur. For instance, in CcsBA, mutations H761A and H897A caused shifts in the Soret maxima for both reduced (427 and 416 nm compared to wild-type) and oxidized (415 and 411 nm) forms . The α maxima also showed a blue shift of approximately 2 nm (to 560 nm), consistent with the effects observed when histidine axial ligands are mutated to alanine in other cytochromes .
These spectroscopic characteristics provide valuable tools for researchers to:
Confirm that recombinant ccmC is correctly folded
Verify heme binding
Assess the oxidation state of bound heme
Evaluate the effects of mutations on heme coordination
The interaction between CcmC and CcmE represents one of the most critical protein-protein associations in the cytochrome c maturation pathway. This interaction leads to the formation of holo-CcmE, a key intermediate in the process of cytochrome c biogenesis . Advanced research has revealed several specific residues that mediate this interaction.
Site-directed mutagenesis studies have identified that specific charged and polar residues are essential for the CcmC-CcmE interaction. For example, mutations in CcmE (R73A/D101A/E105A) completely abolished the production of holo-CcmE and holo-c550, while the total amount of CcmE remained unaffected . This finding indicates that these residues are critical for the functional interaction between the two proteins rather than for CcmE stability.
Similarly, specific residues in CcmC, including Asp47, Gln50, and Arg55, have been identified as interaction partners with Arg73 of CcmE . Mutations of these residues disrupt the formation of holo-CcmE and subsequently impair cytochrome c maturation.
Importantly, research using NMR spectroscopy has determined that CcmC and CcmE associate via protein-protein contacts rather than protein-heme interactions . This finding is significant as it clarifies the mechanism of complex formation and suggests that heme is transferred between specific binding sites on the two proteins rather than serving as a bridge for their interaction.
The table below summarizes key residues involved in the CcmC-CcmE interaction:
| Protein | Critical Residues | Effect of Mutation |
|---|---|---|
| CcmC | Asp47, Gln50, Arg55 | Disruption of holo-CcmE formation |
| CcmE | Arg73, Asp101, Glu105 | Complete abolishment of holo-CcmE and holo-c550 production |
Understanding these specific interactions provides valuable targets for further research into the mechanisms of heme trafficking and cytochrome c maturation.
Transmembrane histidine residues play a crucial role in heme translocation by ccmC and related proteins. Research on CcsBA, which is functionally related to ccmC, has revealed a sophisticated mechanism involving histidine residues in different domains of the protein .
Two conserved histidine residues located within transmembrane domains (TMDs) have been identified as essential for heme translocation from the cytoplasm to the periplasm. In CcsBA from H. hepaticus, these correspond to His-77 in TMD3 and His-858 in TMD8 . Mutations of these histidines prevent heme from reaching the external heme binding domain, demonstrating their essential role in the heme transport pathway.
Remarkably, when these transmembrane histidines are mutated, the function can be partially restored by adding exogenous imidazole, a histidine side chain mimic . This correction is analogous to the restoration of heme binding in myoglobin when its proximal histidine is mutated (H93G), where imidazole binds in the cavity created by the mutation to restore function. This evidence strongly suggests that these transmembrane histidines form a low-affinity heme binding site within the membrane bilayer.
In addition to the transmembrane histidines, two external histidines (His-761 and His-897 in H. hepaticus CcsBA) form an "external heme binding domain" where they serve as axial ligands to the heme iron . These histidines not only bind heme but also protect it from oxidation in the periplasmic environment, which is crucial because only reduced (Fe²⁺) heme can form correct covalent bonds with apocytochrome c.
The proposed mechanism involves:
Reduced heme from the cytoplasm binding to the low-affinity site formed by the transmembrane histidines
Translocation through a channel formed by the protein's TMDs
Transfer to the high-affinity external binding site where the heme is protected from oxidation
Positioning of the heme for interaction with the apocytochrome c CXXCH motif
This sophisticated arrangement of histidine residues creates a pathway for controlled heme trafficking across the membrane while maintaining the heme in its reduced state.
Research on ccmC interactions has benefited from a combination of in vivo and in vitro methodological approaches. Based on the published literature, the following techniques have proven particularly effective:
1. Site-Directed Mutagenesis:
Site-directed mutagenesis has been instrumental in identifying critical residues involved in ccmC function. By systematically mutating conserved residues and assessing the impact on cytochrome c maturation and heme transport, researchers have mapped functional domains and interaction sites . This approach has revealed the importance of specific histidine residues in heme binding and transport, as well as charged residues involved in protein-protein interactions.
2. NMR Spectroscopy:
Nuclear Magnetic Resonance (NMR) spectroscopy has provided valuable insights into the nature of interactions between ccmC and its partner proteins. NMR studies have demonstrated that the interaction between CcmC and CcmE occurs through protein-protein contacts rather than protein-heme interactions . This technique is particularly useful for studying the structural dynamics of these interactions in solution.
3. UV-Visible Absorption Spectroscopy:
UV-visible spectroscopy has been effectively employed to characterize the heme-binding properties of ccmC and related proteins. The spectral features of heme bound to the protein provide information about the oxidation state of the heme iron and the nature of its axial ligands . Changes in absorption spectra upon mutation of key residues have helped identify those involved in heme coordination.
4. Functional Complementation Assays:
These assays involve expressing recombinant ccmC in bacterial strains deficient in cytochrome c maturation and assessing restoration of function. Such approaches have been used to confirm the functionality of recombinant proteins and to evaluate the impact of mutations .
5. Biochemical Purification and Reconstitution:
Purification of recombinant ccmC with fusion tags (such as His-tag or GST) followed by reconstitution experiments has allowed detailed biochemical characterization . For instance, CcsBA from H. hepaticus was expressed as a GST fusion, purified, and shown to restore cytochrome c synthesis in E. coli .
6. Chemiluminescent Heme Detection:
This technique has been used to detect heme associated with purified proteins after separation by SDS-PAGE, providing evidence for non-covalent heme binding .
For researchers planning to study ccmC interactions, a multi-technique approach is recommended, combining genetic methods for identifying key residues with biophysical and biochemical approaches to characterize the resulting interactions in detail.
The ccmC protein and its mechanism of action show both conservation and variation across different bacterial species, reflecting adaptation to diverse environmental niches while maintaining the essential function of heme export for cytochrome c maturation.
Conservation of Key Elements:
Across various bacteria, including Haemophilus influenzae, Escherichia coli, and Helicobacter species, certain features of ccmC are highly conserved:
The presence of multiple transmembrane domains that form a channel for heme translocation .
Conserved histidine residues in transmembrane domains that are essential for heme transport. These histidines appear to be universally required for function across species .
The fundamental mechanism of heme export from the cytoplasm to the periplasm and protection of heme from oxidation.
Variations Between Species:
Despite these conserved features, significant variations exist:
Protein Organization: While most bacterial and plant genomes encode individual ccmC and ccmA genes, in some organisms such as Helicobacter hepaticus, the proteins are naturally fused into a single large ORF, ccmBA . This fusion may confer advantages in terms of coordinated expression and function.
Specificity for Different Cytochrome c Types: In Wolinella succinogenes, three fused CcsBA proteins have been identified that recognize different apocytochrome c motifs (CXXCH, CXXCK, and CX15CH), indicating adaptation to different cytochrome c variants .
Genomic Context: In different H. influenzae strains, there are significant variations in genome architecture. For example, strain 86-028NP (a clinical isolate from a patient with chronic otitis media) shows large rearrangements relative to strain Rd . These genomic differences may influence the regulation and function of ccmC.
Association with Mobile Genetic Elements: In some H. influenzae strains, certain genes show homology to elements found in plasmids, suggesting potential horizontal gene transfer events that may contribute to functional diversity .
The comparative analysis of ccmC across species provides valuable insights into both the core mechanisms required for cytochrome c maturation and the adaptations that have evolved to meet the specific requirements of different bacterial species in their respective ecological niches.
Working with recombinant ccmC protein presents several experimental challenges that researchers should anticipate and address to obtain reliable results. These considerations span from expression and purification to storage and functional assays.
Expression and Purification Challenges:
Membrane Protein Solubilization: As an integral membrane protein, ccmC requires careful solubilization with appropriate detergents. n-Dodecyl β-d-maltoside (DDM) has been successfully used for related proteins and may be suitable for ccmC .
Proteolytic Susceptibility: Related proteins like CcsB show natural proteolytic susceptibility, which can complicate purification efforts . Including protease inhibitors during purification and careful monitoring of protein integrity is advisable.
Expression Levels: Membrane proteins often express at lower levels than soluble proteins. Optimization of expression conditions (temperature, induction time, media composition) may be necessary to improve yields.
Storage and Stability:
Prevention of Aggregation: To maintain protein solubility and prevent aggregation, storage buffer optimization is critical. The recommended storage buffer for recombinant ccmC is Tris/PBS-based buffer with 6% trehalose at pH 8.0 .
Avoiding Freeze-Thaw Cycles: Repeated freezing and thawing should be avoided as it can compromise protein integrity. For long-term storage, aliquoting with glycerol (recommended final concentration of 50%) and storing at -20°C/-80°C is advisable .
Reconstitution Protocol: When reconstituting lyophilized protein, it's recommended to briefly centrifuge the vial prior to opening and to use deionized sterile water to reach a concentration of 0.1-1.0 mg/mL .
Functional Assays:
Heme Oxidation State: Since the function of ccmC involves transporting reduced (Fe²⁺) heme, maintaining the appropriate redox environment during experiments is crucial. Oxidation of heme can occur rapidly in aerobic conditions and may affect functional assays .
Protein-Protein Interactions: When studying interactions with partner proteins like CcmE, conditions must be optimized to maintain the native conformation of both interaction partners .
Spectroscopic Analysis: For UV-visible spectroscopy of heme-binding properties, consideration must be given to potential interference from buffer components or detergents. Proper baseline corrections and controls are essential.
Mutation Analysis:
When performing site-directed mutagenesis to study structure-function relationships, careful consideration should be given to:
Conservation Analysis: Targeting residues that are conserved across species increases the likelihood of identifying functionally important sites .
Chemical Properties: When replacing amino acids, considering the chemical properties of substitutions (charge, size, hydrophobicity) is important for interpreting results.
Complementation Controls: Including appropriate positive and negative controls in functional complementation assays is essential for reliable interpretation of mutation effects.
By addressing these experimental considerations, researchers can enhance the quality and reliability of their studies on recombinant ccmC protein.
Despite significant advances in understanding ccmC function, several important knowledge gaps remain that present opportunities for future research:
Detailed Structural Information: While functional studies have identified key residues and domains, high-resolution structural information (e.g., from X-ray crystallography or cryo-EM) is still lacking for ccmC and most components of the cytochrome c maturation system. Such structural data would provide crucial insights into the mechanism of heme transport and the precise nature of protein-protein interactions .
Energetics of Heme Transport: The energetic basis for heme transport across the membrane remains uncertain. Current models suggest passive translocation driven by a concentration gradient, but active transport mechanisms cannot be ruled out . Clarifying whether ATP hydrolysis or other energy sources contribute to heme transport would significantly advance our understanding.
Temporal Dynamics of Protein Interactions: The sequence and timing of interactions between ccmC and other components of the cytochrome c maturation system are not fully characterized. Real-time monitoring of these interactions would provide insights into the orchestration of this complex process.
Species-Specific Adaptations: While core functions are conserved, the adaptations of the ccmC system in different bacterial species and environmental conditions are not well understood . Comparative studies across diverse species could reveal how this system has evolved to meet different ecological demands.
Regulatory Mechanisms: How the expression and activity of ccmC are regulated in response to changing environmental conditions, including oxygen availability and iron limitation, remains to be fully elucidated.
Addressing these knowledge gaps will require innovative experimental approaches combining structural biology, biophysical techniques, and systems biology perspectives. Such advances would not only enhance our understanding of bacterial cytochrome c maturation but could also inform broader questions about protein-mediated heme trafficking in biological systems.
Research on ccmC extends beyond its specific role in cytochrome c maturation to inform our understanding of several fundamental aspects of bacterial physiology:
Bacterial Energy Metabolism: Since cytochromes c are essential components of electron transport chains, understanding their maturation via ccmC provides insights into bacterial energy metabolism and adaptation to different growth conditions. This knowledge is particularly relevant for understanding bacterial survival in microaerobic or anaerobic environments where cytochromes play crucial roles .
Membrane Protein Biogenesis and Topology: Studies of ccmC transmembrane domains and their orientation provide valuable models for understanding the biogenesis and topology of complex membrane proteins. The mechanisms by which hydrophilic molecules like heme are transported across hydrophobic membrane barriers represent fundamental principles in membrane biology .
Metal Homeostasis: By studying ccmC's role in heme transport, researchers gain insights into iron homeostasis in bacteria. Heme represents a significant pool of iron, and its trafficking must be tightly regulated to maintain appropriate iron levels while avoiding toxicity.
Bacterial Pathogenesis: In pathogens like Haemophilus influenzae, cytochrome c maturation and heme acquisition are linked to virulence. H. influenzae cannot synthesize heme de novo and must acquire it from the host, making heme acquisition systems potential targets for antimicrobial development .
Evolution of Protein Complexes: The variation in organization of cytochrome c maturation proteins across species (e.g., separate ccmC and ccmA in some species versus fused ccmBA in others) provides a window into the evolution of multi-protein complexes and their functional adaptations .
By advancing our understanding of these broader physiological processes, ccmC research contributes to fundamental knowledge that may ultimately inform various applications, from the development of new antimicrobial strategies to biotechnological approaches for engineering bacterial electron transport systems.