Recombinant Haemophilus influenzae Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; CGSHiGG_06210; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Haemophilus influenzae (strain PittGG)
Target Names
mscL
Target Protein Sequence
MNFIKEFREFAMRGNVVDMAIGVIIGSAFGKIVSSLVSDIFTPVLGILTGGIDFKDMKFV LAQAQGDVPAVTLNYGLFIQNVIDFIIIAFAIFMMIKVINKVRKPEEKKTAPKAETLLTE IRDLLKNK
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Structure and Function of Haemophilus influenzae MscL?

The Haemophilus influenzae MscL is a homopentameric membrane protein that functions as a pressure-relief valve during osmotic shock. Similar to other bacterial MscL proteins, it contains:

  • Two transmembrane α-helices per subunit arranged in an up-down/nearest neighbor topology

  • A funnel-shaped permeation pathway with a wider opening at the extracellular side

  • A narrower pore at the cytoplasmic side that functions as a hydrophobic gate

  • A third cytoplasmic α-helix that contributes to channel regulation

The H. influenzae MscL shares structural similarity with the crystallized Mycobacterium tuberculosis MscL homolog, which was determined by x-ray crystallography to 3.5 angstroms resolution. The MscL channel has a large conductance (approximately 3 nS) with a pore diameter of approximately 30 Å when fully open, allowing the passage of ions, water, and small proteins .

When activated by membrane tension during hypoosmotic shock, MscL allows the rapid discharge of cytoplasmic solutes, enabling the cell to reach osmotic homeostasis and prevent membrane damage .

What Expression Systems Are Recommended for Recombinant H. influenzae MscL?

The most successful expression systems for recombinant H. influenzae MscL include:

  • E. coli-based systems: C41(DE3) strain has shown significant success for membrane protein expression, including MscL

  • IPTG-inducible promoters: T7-based expression systems allow controlled expression of recombinant proteins

  • Vector selection: pRSET-A and similar vectors with affinity tags facilitate purification

Methodology notes:

  • Culture the transformed E. coli to mid-logarithmic phase at 37°C in LB medium with appropriate antibiotics

  • Induce protein expression with IPTG (typically 0.5-1.0 mM)

  • Continue incubation for 3-4 hours with constant shaking

  • Harvest cells by centrifugation at 8000 × g for 5 min at 4°C

  • Resuspend in buffer containing Tris-HCl, NaCl, and imidazole

  • Disrupt cells by sonication and separate soluble and membrane fractions

How Can H. influenzae MscL Expression Be Optimized?

Several parameters can be optimized to improve the expression of functional H. influenzae MscL:

Key optimization parameters:

ParameterOptimization RangeEffect on Expression
Initial cell density1.5-6.0 × 10^6 cells/mlHigher densities may increase yield but affect protein folding
IPTG concentration0.3-1.0 mMLower concentrations can improve folding of membrane proteins
Induction temperature22-28°CLower temperatures (23-25°C) often improve membrane protein folding
Induction time3-16 hoursLonger times at lower temperatures may increase yield
Media supplementsGlycerol (0.5-2%), Glucose (10-20 g/L)May stabilize membrane proteins during expression
Detergent selectionDDM, LDAO, OGCritical for extraction and maintaining protein stability

Box-Behnken experimental design approaches have proven effective for optimizing multiple parameters simultaneously rather than one-at-a-time optimization strategies .

What Purification Methods Are Most Effective for H. influenzae MscL?

Purification of recombinant H. influenzae MscL typically involves:

  • Membrane isolation: Differential centrifugation (8,000-10,000 × g for cell debris, followed by 100,000 × g for membrane fraction)

  • Solubilization: Use of mild detergents (DDM, LDAO) at concentrations above their critical micelle concentration

  • Affinity chromatography: Ni-NTA for His-tagged constructs (binding buffer: 20 mM Tris-HCl pH 8.0, 500 mM NaCl, 5-20 mM imidazole)

  • Size exclusion chromatography: To remove aggregates and obtain homogeneous protein preparations

  • Detergent exchange: If required for functional or structural studies

For higher purity, two chromatography steps are typically sufficient to achieve apparent homogeneity, as demonstrated with other H. influenzae membrane proteins .

How Do Lipid Modifications Affect H. influenzae MscL Properties?

Lipidation significantly impacts the properties of H. influenzae membrane proteins:

  • Expression patterns: Lipidated proteins like MscL are predominantly expressed in diacylated form in standard E. coli expression systems

  • Enhanced immunogenicity: Lipidated forms (L-proteins) stimulate higher adaptive immune responses compared to non-lipidated (NL) forms

  • TLR2 activation: Bacterial lipoproteins induce host innate immune responses through mammalian Toll-like receptor 2 (TLR2)

  • Structural implications: Lipid moieties anchor the protein to the membrane and can affect protein-protein interactions

To enhance triacylation (found in some Gram-positive and most Gram-negative bacteria), additional gene copies of apolipoprotein N-acetyltransferase enzyme (Lnt) can be introduced to further acylate diacyl lipoproteins .

What Methods Are Used to Characterize Recombinant H. influenzae MscL Function?

Several approaches are employed to assess the functionality of recombinant H. influenzae MscL:

Electrophysiological approaches:

  • Patch clamp analysis: Records single-channel activity and conductance (approximately 3 nS for MscL)

  • Planar lipid bilayer recordings: Measures channel activity in reconstituted membranes

Biophysical characterization:

  • Flow cytometry: Evaluates surface expression and accessibility

  • Mass spectrometry (LC/MS, MALDI-TOF): Confirms protein identity and post-translational modifications

  • Circular dichroism: Assesses secondary structure content

Functional assays:

  • Hypoosmotic shock survival assays: Tests if MscL expression complements MscL-null strains

  • Small molecule release assays: Measures efflux of fluorescent markers during osmotic downshock

  • Compound response tests: Evaluates response to known MscL activators like SCH-79797

What Strategies Can Be Used to Obtain Sufficient Quantities of Purified H. influenzae MscL for Structural Studies?

Obtaining sufficient quantities of purified H. influenzae MscL for structural studies requires:

  • Scale-up strategies:

    • Bioreactor cultivation in fed-batch mode (optimally with 5.37% feed supplementation)

    • High cell density cultures (5-6 × 10^6 cells/ml)

    • Expression at reduced temperatures (23-25°C)

  • Construct optimization:

    • Removal or replacement of the native signal sequence with one for protein secretion

    • Addition of fusion tags that enhance solubility (MBP, SUMO)

    • Codon optimization for the expression host

  • Purification enhancements:

    • Detergent screening (DDM, LDAO, OG, C12E8) for optimal extraction

    • Buffer optimization to maintain protein stability

    • Addition of stabilizing lipids during purification

  • Quality control methods:

    • Size-exclusion chromatography to assess oligomeric state

    • Dynamic light scattering to confirm homogeneity

    • Negative stain electron microscopy to verify pentameric assembly

    • Thermal stability assays to identify stabilizing conditions

Using these approaches, yields of 20-40 mg/L of purified recombinant MscL protein have been achieved with other membrane proteins from H. influenzae .

What Site-Directed Mutagenesis Approaches Are Most Informative for H. influenzae MscL Functional Studies?

Key site-directed mutagenesis targets for H. influenzae MscL include:

  • Pore-lining residues: Mutations at positions equivalent to E. coli MscL's L19 and V23 that constrict the pore

  • Tension-sensing residues: Mutations in the membrane-facing segments that alter gating characteristics

  • Binding pocket residues: Mutations at the S1-TM2 interface, including positions E6, F10, and K97, which affect compound binding

  • Intersubunit interface residues: Mutations that affect subunit interactions and stability

  • Cytoplasmic domain mutations: Alterations that affect channel regulation and gating

Methodology for mutational analysis:

  • Design primers with appropriate mismatches to generate desired mutations

  • Perform PCR with high-fidelity polymerase

  • Transform into methylation-deficient E. coli strains

  • Confirm mutations by sequencing

  • Express and purify mutant proteins

  • Compare functional properties using electrophysiology and hypoosmotic shock survival assays

How Can Recombinant H. influenzae MscL Be Used in Vaccine Development?

Recombinant H. influenzae MscL shows potential as a vaccine component through several approaches:

  • Direct antigen use:

    • Lipidated MscL stimulates stronger adaptive immune responses than non-lipidated forms

    • Diacylated forms induce higher adaptive immune responses compared to triacylated forms

  • Fusion protein strategies:

    • MscL can be fused with other H. influenzae antigens like P6

    • Example: L-OMP26φNL-P6 fusion protein shows similar lipidation patterns to L-OMP26 alone

  • Delivery methods:

    • Intranasal immunization with recombinant proteins plus appropriate adjuvants

    • Adjuvant selection: Cholera toxin (CT) or adamantylamide dipeptide (AdDP) enhance mucosal responses

  • Immune response assessment:

    • IgG antibody titers in serum

    • IgA antibody levels in nasopharyngeal washings (NPW)

    • Bacterial clearance in mouse models

Studies with other H. influenzae antigens showed that intranasal immunization with lipidated recombinant proteins plus adjuvants elicited protective immune responses, making this a promising approach for MscL-based vaccine development .

What Methods Are Used to Assess the Membrane Integration of Recombinant H. influenzae MscL?

Assessing proper membrane integration of recombinant H. influenzae MscL involves:

  • Subcellular fractionation:

    • Separation of cytoplasmic, periplasmic, and membrane fractions by differential centrifugation

    • Western blot analysis using anti-MscL antibodies

    • Comparison with known membrane protein markers

  • Protease accessibility assays:

    • Treatment of intact cells, spheroplasts, or inverted membrane vesicles with proteases

    • Analysis of protected fragments by SDS-PAGE and immunoblotting

    • Determination of membrane topology based on cleavage patterns

  • Fluorescence-based approaches:

    • GFP fusion constructs to visualize membrane localization

    • Fluorescence microscopy to assess cellular distribution

    • FRET-based assays to evaluate protein-protein interactions in the membrane

  • Biophysical methods:

    • Sucrose density gradient centrifugation to separate different membrane compartments

    • Fourier-transform infrared spectroscopy (FTIR) to assess secondary structure in membrane environments

    • Atomic force microscopy to visualize protein integration in reconstituted membranes

How Can Molecular Dynamics Simulations Enhance Understanding of H. influenzae MscL?

Molecular dynamics (MD) simulations offer valuable insights into H. influenzae MscL structure and function:

  • Structural dynamics:

    • Root-mean-square deviations (RMSDs) analysis to assess protein stability

    • Identification of flexible regions and conformational changes during gating

    • Characterization of water and ion pathways through the channel

  • Gating mechanisms:

    • Simulation of membrane tension effects on channel opening

    • Free energy calculations for different conformational states

    • Identification of critical residues involved in mechanosensing

  • Ligand interactions:

    • Docking studies to identify potential binding sites for compounds

    • MM-PBSA-WSAS free energy calculations to determine binding affinities

    • Simulation of ligand-induced conformational changes

  • Comparative analyses:

    • Differences between H. influenzae MscL and other bacterial homologs

    • Effect of key amino acid substitutions (e.g., M19 in H. influenzae vs. L19 in E. coli)

    • Prediction of functional consequences of mutations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.