Recombinant Haemophilus influenzae Lipid A biosynthesis (KDO)2- (lauroyl)-lipid IVA acyltransferase

Shipped with Ice Packs
In Stock
Cat. No.
BT2498244
Source
in vitro E.coli expression system
Synonyms
lpxM; msbB; HI_0199; Lipid A biosynthesis myristoyltransferase; Kdo(2-lauroyl-lipid IV(A myristoyltransferase
Quick Inquiry

Description

Introduction to Lipid A Biosynthesis

Lipid A is a crucial component of lipopolysaccharide (LPS), a major constituent of the outer membrane of Gram-negative bacteria, including Haemophilus influenzae. It plays a significant role in bacterial pathogenicity and elicits a strong immune response. The biosynthesis of lipid A involves several enzyme-catalyzed steps, with acyltransferases being key enzymes in this process.

General Lipid A Biosynthesis Pathway

The lipid A biosynthesis pathway is well-conserved across Gram-negative bacteria. It involves nine enzyme-catalyzed steps, starting from UDP-N-acetylglucosamine and ending with the mature lipid A molecule. Key enzymes include LpxA, LpxB, LpxC, LpxD, LpxH, LpxK, and WaaA (also known as KdtA) .

Role of KDO in Lipid A Biosynthesis

KDO (3-deoxy-D-manno-oct-2-ulosonic acid) is a component that links lipid A to the core oligosaccharide of LPS. The presence of KDO is crucial for the biological activity of LPS. In Neisseria meningitidis, KDO-containing lipid A derivatives have been shown to enhance immune responses compared to lipid A alone .

Potential Applications and Future Directions

Understanding lipid A biosynthesis and its enzymes can lead to the development of novel antimicrobial strategies. Inhibitors targeting key enzymes in lipid metabolism, such as FabH, have been explored as potential therapeutic agents against Haemophilus influenzae .

Data Table: Key Enzymes in Lipid A Biosynthesis

EnzymeFunction
LpxAUDP-N-acetylglucosamine acyltransferase
LpxBAcyltransferase adding the second acyl chain
LpxCDeacetylase
LpxDAcyltransferase adding the third acyl chain
LpxHDehydratase
LpxKKinase
WaaAKDO transferase

References

- Haemophilus influenzae - Lipopolysaccharide Biosynthesis Genes...
- A Complete Pathway Model for Lipid A Biosynthesis in Escherichia coli
- Influence of cellular lipid content on influenza A virus replication
- Purification and characterization of a recombinant Haemophilus...
- A Complete Pathway Model for Lipid A Biosynthesis in Escherichia coli
- Innate Immune Responses of Synthetic Lipid A Derivatives of Neisseria meningitidis
- Haemophilus influenzae Rd Lacks a Stringently Conserved Fatty...
- Gut Microbiome-Based Analysis of Lipid A Biosynthesis in...
- Interrogation of Essentiality in the Reconstructed Haemophilus influenzae Metabolic Network Identifies Lipid Metabolism Antimicrobial Targets: Preclinical Evaluation of a FabH β-Ketoacyl-ACP Synthase Inhibitor

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to ensure contents settle. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lpxM; msbB; HI_0199; Lipid A biosynthesis myristoyltransferase; Kdo(2-lauroyl-lipid IV(A myristoyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
lpxM
Target Protein Sequence
MSDNQQNLRLTARVGYEAHFSWSYLKPQYWGIWLGIFFLLLLAFVPFRLRDKLTGKLGIW IGHKAKKQRTRAQTNLQYCFPHWTEQQREQVIDKMFAVVAQVMFGIGEIAIRSKKHLQKR SEFIGLEHIEQAKAEGKNIILMVPHGWAIDASGIILHTQGMPMTSMYNPHRNPLVDWLWT ITRQRFGGKMHARQNGIKPFLSHVRKGEMGYYLPDEDFGAEQSVFVDFFGTYKATLPGLN KMAKLSKAVVIPMFPRYNAETGKYEMEIHPAMNLSDDPEQSARAMNEEIESFVTPAPEQY VWILQLLRTRKDGEDLYD
Uniprot No.
P44567

Target Background

Function
This enzyme catalyzes the transfer of myristate from myristoyl-acyl carrier protein (ACP) to Kdo(2)-(lauroyl)-lipid IV(A), resulting in the formation of Kdo(2)-lipid A.
Database Links

KEGG: hin:HI0199

STRING: 71421.HI0199

Protein Families
LpxL/LpxM/LpxP family, LpxM subfamily
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.