Recombinant Haemophilus influenzae Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Haemophilus influenzae Lipid A Export ATP-Binding/Permease Protein MsbA (msbA)

Recombinant Haemophilus influenzae Lipid A export ATP-binding/permease protein MsbA (msbA) is a genetically engineered variant of the essential ABC (ATP-binding cassette) transporter responsible for lipid A translocation in Gram-negative bacteria. This protein facilitates the ATP-dependent transport of lipid A—a critical component of lipopolysaccharides (LPS) in the outer membrane—from the cytoplasmic to the periplasmic leaflet of the inner membrane . MsbA is indispensable for bacterial viability, making it a target for antibiotic development .

Protein Architecture

  • Domain Organization: MsbA functions as a homodimer, with each monomer containing six transmembrane helices and a cytosolic nucleotide-binding domain (NBD) .

  • Sequence: The recombinant H. influenzae MsbA (UniProt ID: P0A0K1 homolog) includes a 587-amino acid sequence with conserved motifs for ATP hydrolysis (Walker A/B, ABC signature) .

  • Structural Flexibility: MsbA adopts inward-facing, outward-facing, and intermediate conformations during transport, as revealed by X-ray crystallography and cryo-EM .

Mechanism of Action

MsbA operates via an alternating access model:

  1. Substrate Binding: Lipid A binds to the inward-facing transmembrane cavity .

  2. ATP Hydrolysis: ATP binding and hydrolysis at the NBDs drive conformational changes, transitioning the protein to an outward-facing state .

  3. Lipid Release: Lipid A is expelled into the periplasmic leaflet .

Lipid A and Drug Transport

FeatureDetailSource
Substrate SpecificityTransports lipid A and amphipathic drugs (e.g., Hoechst 33342, ethidium)
ATPase ActivityHigh basal ATPase activity (≥1 μmol/min/mg) modulated by lipid binding
Drug ResistanceConfers resistance to antibiotics via efflux; inhibited by lipid A

Reconstituted Activity

  • Lipid Flippase Activity: Purified MsbA reconstituted into E. coli proteoliposomes demonstrated ATP-dependent translocation of fluorescently labeled phospholipids (e.g., NBD-PE) at rates up to 7.7 nmol/mg protein/20 min .

  • Inhibition by Lipid A: Lipid A competitively inhibits phospholipid flipping (IC₅₀ ~5 μM) .

Applications and Implications

  • Antibiotic Target: MsbA’s essential role in lipid A transport makes it a candidate for novel Gram-negative antibiotics .

  • Multidrug Resistance (MDR) Studies: Structural homology with human P-glycoprotein (ABCB1) provides insights into ABC transporter-mediated MDR .

Biochemical Assays

  • ATPase Activity:

    • Basal Activity: 1.2 μmol/min/mg (purified MsbA) .

    • Stimulation: 2-fold increase with lipid A (10 μM) .

  • Binding Affinity:

    • Lipid A: Kₐ ~2 μM (fluorescence quenching) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
msbA; msh-1; HI_0060; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-587
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
msbA
Target Protein Sequence
MQEQKLQENDFSTLQTFKRLWPMIKPFKAGLIVSGVALVFNALADSGLIYLLKPLLDDGF GKANHSFLKMMAFVVVGMIILRGITNFISNYCLAWVSGKVVMTMRRRLFKHLMFMPVSFF DQNSTGRLLSRITYDSQMIASSSSGSLITIVREGAYIISLFAVMFYTSWELTIVLFIIGP IIAVLIRLVSKIFRRLSKNLQDSMGELTSATEQMLKGHKVVLSFGGQHVEEVHFNHVSND MRRKSMKMVTANSISDPVVQVIASLALATVLYLATTPLIAEDNLSAGSFTVVFSSMLAMM RPLKSLTAVNAQFQSGMAACQTLFAILDLEPEKDDGAYKAEPAKGELEFKNVSFAYQGKD ELALNNISFSVPAGKTVALVGRSGSGKSTIANLVTRFYDIEQGEILLDGVNIQDYRLSNL RENCAVVSQQVHLFNDTIANNIAYAAQDKYSREEIIAAAKAAYALEFIEKLPQVFDTVIG ENGTSLSGGQRQRLAIARALLRNSPVLILDEATSALDTESERAIQSALEELKKDRTVVVI AHRLSTIENADEILVIDHGEIRERGNHKTLLEQNGAYKQLHSMQFTG
Uniprot No.

Target Background

Function
This protein plays a role in lipopolysaccharide (LPS) biosynthesis. It translocates lipid A-core from the inner to the outer leaflet of the inner membrane. Transmembrane domains (TMD) form a pore in the inner membrane, and the ATP-binding domain (NBD) is responsible for energy generation.
Database Links

KEGG: hin:HI0060

STRING: 71421.HI0060

Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Haemophilus influenzae and why is it clinically significant?

Haemophilus influenzae is a gram-negative bacterium that remains a common pathogen in adult patients throughout the United States and Europe, despite successful vaccination programs for H. influenzae type b (Hib). It causes a spectrum of clinical manifestations including sinusitis, pneumonia, otitis media, epiglottitis, and meningitis. At least half of invasive H. influenzae infections are caused by nontypable strains, which are not targeted by the Hib vaccine. Definitive diagnosis requires positive cultures from normally sterile sites, and while resistance to ampicillin and amoxicillin has increased over recent decades, several alternative antimicrobial agents remain effective .

What is the fundamental role of MsbA in gram-negative bacteria like H. influenzae?

MsbA functions as an essential lipid A transporter in the inner membrane of gram-negative bacteria, including H. influenzae. This ABC transporter facilitates the flipping of newly synthesized lipid A from the cytoplasmic to the periplasmic leaflet of the inner membrane, a critical step in lipopolysaccharide (LPS) biogenesis. Since LPS is a vital component of the outer membrane that provides structural integrity and serves as a permeability barrier against antimicrobial compounds, MsbA's role is essential for bacterial viability. Disruption of MsbA function leads to accumulation of lipid A at the inner membrane, compromising membrane integrity and ultimately resulting in bacterial cell death.

How does the structure of H. influenzae MsbA compare with homologs in other bacterial species?

H. influenzae MsbA belongs to the ABC transporter superfamily and shares the characteristic architecture of this protein class, featuring two transmembrane domains (TMDs) that form the translocation pathway and two nucleotide-binding domains (NBDs) that bind and hydrolyze ATP. While sharing significant structural homology with MsbA from other gram-negative bacteria like E. coli and Salmonella typhimurium, H. influenzae MsbA exhibits some unique sequence variations that may influence substrate specificity and kinetic properties. These structural variations could be particularly relevant when considering H. influenzae's distinct lipid A composition and the protein's potential as a specific drug target.

What conformational changes occur during the MsbA-mediated lipid A transport cycle?

The MsbA transport cycle involves multiple conformational states that facilitate lipid A translocation across the membrane. Starting from an inward-facing conformation with the substrate binding site accessible from the cytoplasm, ATP binding triggers dimerization of the NBDs, inducing a major conformational change to an outward-facing state. This reorientation exposes the substrate binding site to the periplasm, allowing lipid A release. ATP hydrolysis then resets the transporter to its inward-facing conformation. In H. influenzae, this conformational cycling must accommodate the specific chemical structure of its lipid A, which may contain unique modifications that influence interactions with the transporter binding pocket.

What expression systems are most effective for producing recombinant H. influenzae MsbA?

For recombinant expression of H. influenzae MsbA, E. coli-based systems remain the most widely used due to their efficiency and compatibility with membrane protein expression. The BL21(DE3) strain with pET vector systems provides high-level expression when combined with specific solubilization strategies. For optimal results, expression should be conducted at lower temperatures (16-20°C) with reduced inducer concentrations to prevent inclusion body formation. Alternative expression systems include Pichia pastoris for researchers seeking eukaryotic post-translational modifications, or cell-free systems for rapid screening applications. When designing expression constructs, inclusion of affinity tags (His6, FLAG) at either the N- or C-terminus facilitates purification, though care must be taken to ensure tag positioning doesn't interfere with protein folding or activity.

What purification protocols yield the highest activity for recombinant H. influenzae MsbA?

Successful purification of functional H. influenzae MsbA requires careful selection of detergents and buffer conditions to maintain protein stability and activity. A recommended protocol involves:

  • Membrane solubilization using mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG)

  • Immobilized metal affinity chromatography (IMAC) using His-tagged constructs

  • Size exclusion chromatography (SEC) for further purification and detergent exchange

  • Protein stabilization with appropriate lipids (E. coli total lipid extract or synthetic lipids)

Critical factors affecting yield include maintaining physiological pH (7.2-7.5), including glycerol (10-20%) to prevent aggregation, and adding ATP/Mg²⁺ during purification to stabilize the protein conformation. For functional studies, reconstitution into proteoliposomes or nanodiscs provides a native-like membrane environment that preserves ATPase and transport activities.

What assays can accurately measure the ATPase activity of recombinant H. influenzae MsbA?

Several complementary approaches can be employed to assess the ATPase activity of purified H. influenzae MsbA:

  • Colorimetric phosphate release assays (malachite green or molybdate-based) provide a straightforward measure of ATP hydrolysis by quantifying inorganic phosphate production

  • Coupled enzyme assays linking ATP hydrolysis to NADH oxidation enable continuous monitoring of activity

  • Radiolabeled ATP assays offer high sensitivity for kinetic analyses

For meaningful results, assays should be conducted with appropriate controls including:

  • ATPase inhibitors (orthovanadate, BeFx) to confirm specificity

  • Detergent controls to account for potential interference

  • Lipid substrate supplementation to measure stimulated activity

Temperature optimization is critical for H. influenzae proteins, with maximal activity typically observed at 30-37°C. Activity measurements should examine Michaelis-Menten parameters (Km, Vmax) and the effects of potential inhibitors, with data typically presented as specific activity (nmol Pi/min/mg protein).

How can genetic knockdown/knockout strategies be applied to study msbA in H. influenzae?

Since msbA is an essential gene in H. influenzae, conventional knockout approaches typically result in non-viable cells. Therefore, conditional expression systems offer the most effective genetic approach for studying MsbA function in vivo. Recommended strategies include:

  • Inducible antisense RNA expression to reduce msbA translation

  • CRISPR interference (CRISPRi) with catalytically inactive Cas9 for transcriptional repression

  • Tetracycline-responsive promoter replacement for controlled expression

  • Temperature-sensitive alleles that maintain function under permissive conditions

When implementing these systems, researchers should carefully monitor growth phenotypes, membrane integrity, and lipid A transport. Complementation with wild-type or mutant msbA variants can confirm phenotype specificity and facilitate structure-function analyses. For H. influenzae specifically, transformation efficiency and natural competence must be considered when designing genetic manipulation protocols.

What lipid A structural differences exist in H. influenzae compared to other gram-negative bacteria and how might they affect MsbA function?

H. influenzae produces a distinct lipid A structure compared to model organisms like E. coli. Key differences include:

  • Shorter acyl chains (predominantly C14 rather than C14-C16)

  • Distinct phosphate modifications and substitution patterns

  • Unique patterns of glycosylation

These structural variations likely influence interactions with MsbA's substrate binding pocket and may affect transport kinetics and efficiency. Researchers studying H. influenzae MsbA should consider these species-specific lipid A characteristics when interpreting functional data or designing inhibitors. Mass spectrometry techniques (MALDI-TOF, LC-MS/MS) combined with thin-layer chromatography provide the most comprehensive approach for characterizing these structural differences and their functional implications.

How does H. influenzae antimicrobial resistance relate to MsbA function?

  • Correlation between MsbA sequence variations and minimum inhibitory concentrations (MICs) for various antibiotics

  • Changes in membrane permeability in strains with altered MsbA activity

  • Potential effects of sub-inhibitory antibiotic concentrations on msbA expression

  • Interactions between MsbA and other resistance mechanisms (efflux pumps, β-lactamases)

This research area represents an important frontier in understanding H. influenzae pathogenicity and designing more effective antimicrobial strategies.

What is the potential of H. influenzae MsbA as a novel antimicrobial target?

MsbA presents a promising antimicrobial target due to its essential role in gram-negative bacterial viability. For H. influenzae specifically, targeting MsbA offers several advantages:

  • Essential function with no human homolog, reducing toxicity concerns

  • Accessible location in the inner membrane

  • Druggable ATP-binding pocket and substrate binding site

  • Potential to overcome existing resistance mechanisms

High-throughput screening campaigns using ATPase activity assays can identify potential inhibitors, which should be followed by secondary validation through lipid A transport assays and whole-cell antimicrobial testing. Structure-based drug design approaches may leverage homology models based on crystal structures from related bacteria. When evaluating candidate inhibitors, researchers should assess:

  • Specificity for H. influenzae MsbA versus other bacterial homologs

  • Activity against clinical isolates with diverse resistance profiles

  • Effects on biofilm formation and persistence

  • Synergy with existing antibiotics

How do post-translational modifications affect H. influenzae MsbA function?

While post-translational modifications (PTMs) of MsbA remain largely unexplored in H. influenzae, emerging evidence from related bacteria suggests that phosphorylation, methylation, and other modifications may regulate transporter activity. Advanced mass spectrometry techniques can identify PTMs in native and recombinant MsbA. Researchers should investigate:

  • PTM profiles under different growth conditions and stress responses

  • Enzymatic systems responsible for MsbA modifications

  • Functional consequences of specific modifications on transport activity

  • Conservation of modification sites across Haemophilus species

Site-directed mutagenesis of potential modification sites, coupled with in vitro and in vivo functional assays, can establish causal relationships between specific PTMs and transporter function. This emerging area may reveal new regulatory mechanisms controlling lipid A transport and membrane biogenesis in H. influenzae.

What is the relationship between H. influenzae MsbA and the bacterial stress response?

MsbA function likely intersects with multiple stress response pathways in H. influenzae. During environmental stress (pH changes, antimicrobial exposure, nutrient limitation), bacteria often modify their lipid A structure, potentially altering MsbA substrate specificity or transport requirements. Key research questions include:

  • How does msbA expression change during various stress conditions?

  • Do stress-induced lipid A modifications affect MsbA transport efficiency?

  • Is MsbA activity regulated by stress response systems like two-component regulatory systems?

  • Could targeting MsbA during specific stress conditions enhance antimicrobial efficacy?

Transcriptomic and proteomic approaches can identify regulatory networks connecting MsbA to stress responses, while biochemical assays examining MsbA activity under stress-mimicking conditions can provide functional insights. This research direction has particular relevance for understanding H. influenzae persistence during infection and antibiotic treatment.

How can PCR-based methods specifically detect H. influenzae and distinguish it from H. haemolyticus?

PCR-based identification of H. influenzae remains challenging due to its genetic similarity with commensal H. haemolyticus. Misidentifications are frequent in diagnostic settings, though the problem is quantitatively small compared to the risk of confusing colonization with infection . Researchers should consider the following PCR targets for specific identification:

  • The P6 gene (protein P6/pal) with sequence analysis of variable regions

  • The lgtC gene (absent in H. haemolyticus)

  • The fucK gene (encoding fuculokinase)

  • The hpd gene (protein D)

A multiplex PCR approach targeting several genes simultaneously provides the most reliable discrimination. When developing new diagnostic assays, validation should include diverse clinical isolates, particularly from oropharynx-associated sites where H. haemolyticus is most commonly found. Combining molecular identification with MALDI-TOF MS analysis offers complementary approaches to improve diagnostic accuracy in both research and clinical settings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.