Recombinant Haemophilus influenzae Lipopolysaccharide export system permease protein lptF (lptF)

Shipped with Ice Packs
In Stock

Description

Functional Mechanism

  • LPS extraction is powered by ATP hydrolysis via LptB.

  • LptF and LptG form lateral gates to transfer LPS to LptA, which shuttles it across the periplasm .

Research Findings and Mutational Studies

Recent studies highlight LptF’s regulatory roles:

Suppressor Mutations

  • The R212G mutation in LptF restores LPS transport in ΔlptC strains by enabling direct interaction between LptF and LptA .

  • Despite bypassing LptC, these mutants retain sensitivity to stressors like novobiocin, indicating residual functional deficits .

ATPase Activity

Lpt ComplexATP Hydrolysis RateLPS Transport Efficiency
Wild-type LptB2_2FGCLowHigh
LptB2_2FG (ΔlptC)HighLow
LptB2_2FG (R212G)ModerateHigh

The R212G mutation restores ATP-LPS coupling efficiency to near-wild-type levels without restoring LptC affinity .

Applications in Research

  • Mechanistic Studies: Used to dissect LPS transport energetics and complex assembly .

  • Antibiotic Development: Target for disrupting OM biogenesis in multidrug-resistant pathogens .

  • Structural Biology: Crystallography reveals cavity architecture and lateral gate dynamics .

References and Data Sources

Key studies include:

  • Structural characterization of LptB2_2FG (PDB: 5L75) .

  • Genetic suppression mechanisms in ΔlptC strains .

  • Functional reconstitution of LPS transport in vitro .

Product Specs

Form
Lyophilized powder
Note: While we strive to ship the format currently in stock, we understand your specific requirements. Should you have a preference for the format, please indicate it during order placement. We will do our best to accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs by default. Should you require dry ice shipping, please communicate this to us beforehand. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
lptF; HI_1704; Lipopolysaccharide export system permease protein LptF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-372
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
lptF
Target Protein Sequence
MILIRYLIKEVFKSQIAILLILLLIFFSQQFVRVLGAAANGNVPADLVFSLLGLGMPTMA QLMLPLCLFIAILLTFGRLYAESEITVMRACGVGQRILVKVALIMSLLTAGIAAYNALWL SPWAIQKQVNMVEDAKANPTVGVLSSGQFISTNNNNVVLFIDKIKDNQIRNVYLFQMTPQ KQTKPSVITAEKGELIALPNGDQVLNLKNTKRVEGTSALPDFRITHFDEYHAYLGYQSAE NTNDEVAELTLSQLIDLDSSSAKAELHWRITLILAVPLMALIAVPLSRVNPRQGRFAKIL PALLLYLIYFLLQSSFKSAGSAGKLEAELLMPLVNIGFFLLAVVLNSWDSEIMYKFRYLF SKKGSAKDDKYP
Uniprot No.

Target Background

Function
Recombinant Haemophilus influenzae Lipopolysaccharide export system permease protein lptF (lptF) plays a crucial role as part of the ABC transporter complex LptBFG. This complex is involved in the translocation of lipopolysaccharide (LPS) from the inner membrane to the outer membrane.
Database Links

KEGG: hin:HI1704

STRING: 71421.HI1704

Protein Families
LptF/LptG family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the lipopolysaccharide export system in Gram-negative bacteria like Haemophilus influenzae?

The lipopolysaccharide (LPS) export system in Gram-negative bacteria constitutes a multi-protein machinery responsible for transporting LPS molecules from their site of synthesis in the inner membrane to the bacterial cell surface. This complex system typically involves seven essential proteins (LptA-G) that form a trans-envelope bridge spanning from the inner membrane to the outer membrane. The LptB₂FG complex forms an ATP-binding cassette (ABC) transporter at the inner membrane that powers the extraction and initial transport of LPS molecules .

In Haemophilus influenzae, this system is particularly critical as LPS (sometimes called lipooligosaccharide or LOS in this organism) serves as a major virulence factor contributing to pathogenesis in conditions such as community-acquired pneumonia, especially in non-typeable H. influenzae (NTHi) strains. The proper assembly and transport of LPS is essential for maintaining outer membrane integrity, which protects the bacterium against host immune defenses and antibiotics .

Unlike many other bacteria, H. influenzae has specific LPS structural features that may influence the exact functioning of the LptF protein in this organism compared to more extensively studied models like Escherichia coli. These differences may impact virulence, antibiotic resistance, and host-pathogen interactions in respiratory infections.

How does the LptF protein function within the lipopolysaccharide export system?

The LptF protein functions as a critical transmembrane permease component of the LptB₂FG complex located at the inner membrane. Based on structural and biochemical studies, LptF contains multiple transmembrane helices that form part of a structural channel, along with a periplasmic β-jellyroll domain that interacts with LPS molecules during transport .

The functional mechanism involves several coordinated steps:

  • LptF and LptG form a heterodimeric channel in the inner membrane

  • LptB dimers associate with the cytoplasmic domains of LptF and LptG

  • ATP hydrolysis by LptB drives conformational changes in LptF and LptG

  • These conformational changes create lateral gates that allow LPS extraction from the membrane

  • The β-jellyroll domain of LptF helps transfer LPS to LptC and subsequently to other components of the transport pathway

Electron spin resonance (ESR) spectroscopy experiments have demonstrated that LptF undergoes significant conformational changes during the LPS export cycle. These dynamic changes include the opening and closing of lateral gates between LptF-TM1 and LptG-TM5, which appears to be coupled with ATP hydrolysis by LptB . This molecular mechanism enables the energetically unfavorable extraction of LPS from the membrane environment and its directed transport to the cell surface.

What is the structural relationship between LptF and other components of the Lpt system?

The structural relationship between LptF and other Lpt components involves complex interactions that drive the LPS transport process. Based on structural and biophysical studies, these relationships can be characterized as follows:

LptF-LptG interaction:

  • LptF and LptG form a heterodimeric core within the inner membrane

  • Their transmembrane domains interact to create lateral gates for LPS passage

  • Distance measurements using DEER/PELDOR spectroscopy show that LptF-TM1 and LptG-TM5 form a lateral gate with significant conformational flexibility

  • Their periplasmic β-jellyroll domains stably interact in both apo and nucleotide-bound states

LptF-LptB interaction:

  • LptB dimers associate with the cytoplasmic domains of LptF and LptG

  • ATP binding and hydrolysis by LptB allosterically couple to selective opening of the LptF β-jellyroll domain

  • Experiments show that "binding of nucleotides is allosterically coupled to a selective opening of LptF β-jellyroll with little effect on the LptG β-jellyroll"

LptF-LptC interaction:

  • The periplasmic β-jellyroll domain of LptF interacts with LptC

  • This interaction facilitates the handover of LPS molecules from the inner membrane complex to the periplasmic components

  • The "flexible lateral gate-2" region appears important for "LptC interaction"

These structural relationships collectively create a coordinated mechanical process that extracts LPS from the inner membrane and propels it through the periplasmic bridge toward the outer membrane, ensuring proper assembly of this essential outer membrane component.

What structural domains characterize the LptF protein and how do they contribute to function?

The LptF protein contains several distinct structural domains that contribute to its function in LPS export:

1. Transmembrane domain:

  • Typically consists of 6 transmembrane helices (based on E. coli structures)

  • TM1 forms part of lateral gate-1 with LptG-TM5, creating an LPS entry point

  • Forms the hydrophobic channel through which LPS molecules are extracted from the membrane

  • Shows "significant conformational flexibility" as demonstrated by spectroscopic studies

2. Periplasmic β-jellyroll domain:

  • Located between TM1 and TM2

  • Adopts a β-sandwich fold with anti-parallel β-strands

  • Contains a hydrophobic groove that binds the acyl chains of LPS

  • Undergoes "selective opening" upon ATP binding to LptB

  • Interacts with the β-jellyroll domain of LptG

3. Cytoplasmic domains:

  • Interact with the nucleotide-binding LptB components

  • Transmit conformational changes from ATP hydrolysis to the transmembrane and periplasmic domains

4. Lateral gate regions:

  • Two key lateral gates have been identified through biophysical studies

  • Lateral gate-1 between LptF-TM1 and LptG-TM5 serves as an "entry point for LPS"

  • Lateral gate-2 involves other transmembrane helices and may play a role in LptC interaction

  • These gates show "enhanced dynamics" that appear "required for efficient interaction with LPS and LptC"

The following table summarizes key structural features identified through biophysical studies:

Structural FeatureLocationFunctionDynamic Behavior
Lateral Gate-1LptF-TM1 – LptG-TM5LPS entry pointBroad distance distribution; high flexibility
Lateral Gate-2Multiple TM helicesLptC interactionEnhanced dynamics; conformational heterogeneity
β-jellyroll domainsPeriplasmic regionLPS bindingStable interaction in apo state; selective opening of LptF β-jellyroll when nucleotide-bound
TM domain interfaceMembrane-embeddedChannel formationMinimal interaction between some helices; "flexibility is inbuilt"

These structural features work in concert to extract LPS molecules from the inner membrane and initiate their transport to the outer membrane, making LptF an essential component of the LPS export machinery.

How conserved is the LptF protein across different bacterial species including Haemophilus influenzae?

The LptF protein demonstrates significant conservation across Gram-negative bacteria, reflecting its essential role in outer membrane biogenesis. While most detailed structural and functional studies have been conducted on E. coli LptF, homologs exist in virtually all Gram-negative bacteria including Haemophilus influenzae.

Key conservation patterns include:

Analysis of H. influenzae clinical isolates has revealed important variations:

  • Non-typeable H. influenzae (NTHi) strains, which cause the majority of H. influenzae infections in the post-vaccination era, show diversity in lptF gene sequences

  • These variations may contribute to differences in virulence and antibiotic susceptibility

  • Sequence polymorphisms in LptF may influence LPS transport efficiency and outer membrane integrity

The conservation of LptF across bacterial species provides a potential target for broad-spectrum antimicrobial development, while species-specific variations might be exploited for more targeted therapeutic approaches against pathogens like H. influenzae.

What techniques are most effective for purifying recombinant LptF protein from Haemophilus influenzae?

Purification of recombinant H. influenzae LptF presents significant challenges due to its multiple transmembrane domains and hydrophobic nature. Based on successful approaches with homologous proteins, the following methodology would be most effective:

Expression system optimization:

  • E. coli C43(DE3) or LOBSTR-BL21(DE3) strains are recommended for membrane protein expression

  • pET-based vectors with a C-terminal His10 tag and a tobacco etch virus (TEV) protease cleavage site

  • Codon optimization for efficient expression in the selected host

  • Induction at low temperature (18-20°C) with extended expression (16-20 hours)

Membrane extraction and solubilization protocol:

  • Harvest cells and resuspend in buffer containing 20 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol

  • Disrupt cells by high-pressure homogenization (15,000-20,000 psi)

  • Remove debris by centrifugation at 10,000 × g for 20 minutes

  • Collect membranes by ultracentrifugation at 100,000 × g for 1 hour

  • Solubilize membranes in buffer containing 1% (w/v) n-dodecyl-β-D-maltopyranoside (DDM) or 1% (w/v) lauryl maltose neopentyl glycol (LMNG)

Chromatographic purification sequence:

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Optional: Tag removal with TEV protease followed by reverse IMAC

  • Size exclusion chromatography using Superdex 200 column in buffer containing 0.03% DDM or 0.01% LMNG

Critical quality control analyses:

  • SDS-PAGE to assess purity (target >95% homogeneity)

  • Western blot with anti-His antibodies or custom antibodies against LptF

  • Mass spectrometry for protein identification and verification

  • Circular dichroism to confirm secondary structure integrity

  • Functional reconstitution assays to verify activity

Protein stabilization measures:

  • Addition of E. coli polar lipid extract (0.01-0.05 mg/ml)

  • Incorporation of stabilizing agents (10% glycerol, 1 mM DTT)

  • For long-term storage, flash-freeze aliquots in liquid nitrogen

This methodology can be adapted from protocols used for E. coli LptF purification described in studies utilizing DEER/PELDOR spectroscopy, which indicated that researchers successfully "purified the proteins and performed all biochemical and ESR spectroscopy experiments" .

How can we characterize the conformational changes in LptF during lipopolysaccharide transport?

Characterizing the conformational dynamics of LptF during LPS transport requires sophisticated biophysical techniques that can capture protein motion in membrane environments. Based on recent advances in the field, the following integrated approach is recommended:

Spectroscopic methods:

  • Electron Spin Resonance (ESR) spectroscopy:

    • Site-directed spin labeling (SDSL) at strategic positions in transmembrane domains and β-jellyroll

    • Double Electron-Electron Resonance (DEER) or Pulsed Electron-Electron Double Resonance (PELDOR) to measure distances between labeled sites

    • Recent studies successfully employed this approach, revealing that "the structures captured two of the states from the broad conformational space"

    • Critical positions to label include residues at the lateral gates and β-jellyroll domains

  • Fluorescence-based approaches:

    • Single-molecule Förster Resonance Energy Transfer (smFRET) with strategically placed donor-acceptor pairs

    • Total Internal Reflection Fluorescence (TIRF) microscopy for membrane-reconstituted LptF

    • Time-resolved fluorescence to capture transient states during the transport cycle

Structural methods:

  • Cryo-electron microscopy (cryo-EM):

    • Single-particle analysis of the entire LptB₂FGC complex in nanodiscs

    • Classification of particles to identify distinct conformational states

    • Time-resolved studies with ATP analogs or transition state mimics

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Maps regions of protein that become protected or exposed during different states

    • Can be performed under various nucleotide-bound states

    • Particularly valuable for identifying dynamic regions not resolved in static structures

Data integration approaches:

  • Integrative structural modeling:

    • Combines data from multiple experimental techniques

    • Generates ensemble models that capture conformational heterogeneity

    • Resolves ambiguities from any single method

  • Kinetic modeling of structural transitions:

    • Uses rate constants determined from time-resolved experiments

    • Creates a quantitative model of the LptF conformational cycle

    • Correlates structural changes with steps in LPS transport

DEER/PELDOR experiments have already revealed important insights, showing "broad distance distributions for the lateral gate-1 between LptF-TM1 and LptG-TM5" suggesting significant conformational heterogeneity . This approach can be extended to systematically map the conformational landscape of LptF during each stage of the transport cycle.

What role does LptF play in antibiotic resistance in Haemophilus influenzae?

The role of LptF in antibiotic resistance in H. influenzae is multifaceted and increasingly important given the rising prevalence of non-typeable H. influenzae (NTHi) infections following widespread vaccination against H. influenzae type b (Hib) .

Direct contributions to intrinsic resistance:

  • Outer membrane permeability barrier:

    • LptF is essential for proper LPS assembly in the outer membrane

    • Intact LPS creates a hydrophobic barrier that prevents entry of many hydrophilic antibiotics

    • NTHi strains have been identified as "an important cause of lower respiratory tract infection, including pneumonia, in adults, especially those with underlying diseases"

  • Adaptive LPS modifications:

    • Alterations in LptF function can modify LPS transport efficiency and composition

    • Changes in LPS structure can reduce binding of antimicrobial peptides and certain antibiotics

    • These modifications may contribute to persistent infections with NTHi

Indirect contributions through stress responses:

  • Envelope stress pathways:

    • Mutations or inhibition of LptF activates envelope stress responses

    • These stress responses upregulate efflux pumps and other resistance mechanisms

    • Cross-protection against multiple antibiotic classes can result

  • Biofilm formation:

    • LPS structure influences biofilm formation capacity

    • NTHi biofilms are increasingly recognized as important in chronic respiratory infections

    • Biofilms provide protection against antibiotics and host immune responses

Clinical implications in H. influenzae infections:

Antibiotic ClassMechanism of Resistance Involving LptFClinical Impact
β-lactamsLPS alterations affecting permeability; synergy with β-lactamasesTreatment failures in respiratory infections
MacrolidesReduced penetration through modified outer membraneReduced efficacy in chronic bronchitis exacerbations
PolymyxinsAltered LPS binding sites due to transport defectsIntrinsic resistance to last-line antibiotics
AminoglycosidesReduced uptake through permeability changesHigher MICs in clinical isolates

Understanding LptF's role in antibiotic resistance is particularly relevant as "NTHi strains and, occasionally, other encapsulated serotypes of H. influenzae are now the cause of the majority of invasive H. influenzae infections, including bacteraemic CAP [community-acquired pneumonia]" . This knowledge could inform new therapeutic strategies targeting the LPS transport system to overcome resistance.

How do mutations in the lptF gene affect the virulence of Haemophilus influenzae?

Mutations in the lptF gene can significantly impact the virulence of Haemophilus influenzae through multiple mechanisms affecting both bacterial survival and host-pathogen interactions.

Effects on LPS/LOS structure and composition:

  • Altered LPS/LOS assembly:

    • Mutations in functional domains of LptF can disrupt efficient LPS transport

    • This leads to altered LPS density and distribution on the cell surface

    • Studies have shown that "Non-typeable H. influenzae (NTHi) strains have long been recognised as an important cause of lower respiratory tract infection" , and their virulence relies heavily on proper LPS structure

  • Phase variation effects:

    • Some lptF mutations influence phase variation in LPS/LOS structures

    • This contributes to immune evasion during infection progression

    • Particularly important in NTHi strains which rely on antigenic variation for persistence

Impact on host-pathogen interactions:

  • Adherence and colonization:

    • LPS/LOS is a key determinant of adherence to respiratory epithelium

    • Mutations affecting LPS transport alter colonization efficiency

    • This may explain why "NTHi strains and, occasionally, other encapsulated serotypes of H. influenzae are now the cause of the majority of invasive H. influenzae infections"

  • Immune evasion mechanisms:

    • Properly transported LPS shields surface antigens from antibody recognition

    • LptF mutations can expose otherwise hidden antigens

    • Conversely, some mutations may enhance serum resistance through altered LPS presentation

  • Inflammatory response modulation:

    • LPS is a potent inflammatory stimulus through TLR4 activation

    • Altered LPS presentation due to LptF mutations affects inflammation intensity

    • This modulation influences tissue damage and bacterial clearance

Experimental approaches to study lptF mutations:

ApproachMethodologyApplicationsKey Findings
Site-directed mutagenesisTargeted mutation of specific LptF domainsStructure-function studiesLateral gates and β-jellyroll domains are critical for function
Clinical isolate comparisonSequencing lptF from diverse patient isolatesCorrelation with disease severitySpecific polymorphisms associated with treatment failure
In vivo infection modelsAnimal models with isogenic strainsVirulence assessmentLptF mutations can attenuate or enhance virulence depending on specific changes
Transcriptomic analysisRNA-seq of wild-type vs. mutant strainsGlobal regulatory effectsLptF mutations trigger compensatory pathways

Recent pediatric studies have found that "Non-type b H. influenzae (presumably NTHi) was identified as the causative agent in 9% (101/1,158) of cases" of community-acquired lower respiratory tract infections , highlighting the clinical importance of understanding virulence factors like LptF in this pathogen.

What experimental approaches can resolve contradictory findings regarding LptF's interaction with LPS?

Contradictory findings regarding LptF's interaction with LPS have emerged from different experimental approaches. Resolving these contradictions requires sophisticated methodologies that can capture the complex and dynamic nature of these interactions:

Structural biology approaches:

  • Cross-linking mass spectrometry (XL-MS):

    • Uses bifunctional cross-linkers to capture transient interactions

    • Identifies specific residues involved in LPS binding

    • Can be performed in native-like membrane environments

    • Particularly useful for resolving contradictions about binding sites

  • Cryo-EM with lipid nanodiscs:

    • Captures membrane proteins in a lipid bilayer environment

    • Can visualize different conformational states with bound LPS

    • Recent studies indicate significant conformational heterogeneity where "the structures captured two of the states from the broad conformational space"

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Maps regions of protein that become protected upon LPS binding

    • Can be performed under various nucleotide-bound states

    • Resolves contradictions about conformational changes induced by LPS

Biophysical interaction studies:

  • Surface plasmon resonance (SPR) with purified components:

    • Measures direct binding kinetics between LptF and LPS

    • Can determine affinity constants under various conditions

    • Useful for resolving contradictions about binding affinity

  • Microscale thermophoresis (MST):

    • Measures interactions in solution without immobilization

    • Requires small sample amounts

    • Can detect subtle changes in binding properties with mutants

Functional reconstitution approaches:

  • Proteoliposome systems with purified components:

    • Reconstitutes LptB₂FG complex in defined lipid environment

    • Allows measurement of actual LPS transport rather than just binding

    • Can incorporate site-specific mutations to test mechanistic models

  • LptF variant complementation studies:

    • Tests functional importance of specific residues in vivo

    • Can resolve contradictions between in vitro binding and physiological relevance

    • Particularly valuable for H. influenzae where genetic tools are available

Addressing specific contradictions:

For example, researchers studying LPS transport using DEER/PELDOR spectroscopy found that "the PLS [proteoliposome] environment modulates the observed conformation in LptB₂FG," with lateral gates showing "a broader distribution in PLS, which is minimally affected by vanadate-trapping" . This environmental sensitivity may explain contradictory results obtained in different experimental systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.