Recombinant Haemophilus influenzae Lipoprotein-releasing system transmembrane protein LolC (lolC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this to us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lolC; HI_1555; Lipoprotein-releasing system transmembrane protein LolC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-393
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
lolC
Target Protein Sequence
MNFPISLYIALRYWRAKSADRFGRLVTNLASLGIVLGVMALIIVLSVMNGLEGYQKQQVL SSIPHAIVSEEQPISTEKTLENLPHFVQKAVPINTTNVIYQTAKGVSAGQIIGIQSFSDD PLVESFDQTKFNEILPRGEFKLVIGDQLAQKLGVNIGDKIRLMITENSQYTPFGRVPMQR LFTVSDIYYGYGEASGYEAFANITDIGRLMRIQPQQAQGYRLFLNDPFQITELPQHFPTQ KITDWRVQKGEFFQAVRMEKNMMGLLISLIIVVAISNIVTSLSLMVVDKQGEIAILQTQG LTKSQVRSVFIYQGLLVGFVGTLLGAILGVLATLNLTDIVSAVNPQGVFLPTELSFVQMI FVIGFSLLLSLLSTLYPAYRAAKVEPAAALRYE
Uniprot No.

Target Background

Function
LolC is a transmembrane protein that is part of the ATP-dependent transport system LolCDE. This system is responsible for releasing lipoproteins targeted to the outer membrane from the inner membrane. This release is dependent on the sorting signal (absence of an Asp at position 2 of the mature lipoprotein) and the presence of LolA.
Database Links

KEGG: hin:HI1555

STRING: 71421.HI1555

Protein Families
ABC-4 integral membrane protein family, LolC/E subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Lipoprotein-releasing system transmembrane protein LolC in Haemophilus influenzae?

LolC is a critical component of the Lol (Lipoprotein outer membrane localization) system in Haemophilus influenzae, functioning as a transmembrane protein involved in the transport of lipoproteins from the inner membrane to the outer membrane. In H. influenzae, LolC is encoded by gene HI1555 and functions as part of the LolCDE complex, which is an ABC transporter that recognizes lipoproteins destined for the outer membrane and facilitates their release from the inner membrane . The protein is crucial for bacterial viability as it ensures proper localization of lipoproteins that perform essential functions in the outer membrane structure and function.

How does H. influenzae LolC differ from LolC proteins in other gram-negative bacteria?

H. influenzae LolC (HI1555) exhibits structural and functional homology with LolC proteins from other gram-negative bacteria like Escherichia coli, but contains specific sequence variations that may affect substrate specificity and transport efficiency. These differences may reflect adaptations to H. influenzae's unique lipoprotein profile and membrane composition . Interestingly, H. influenzae also possesses LolE (encoded by HI1548), which works collaboratively with LolC as part of the LolCDE complex in lipoprotein processing . The specific variations in amino acid sequences between H. influenzae LolC and other bacterial homologs could influence interactions with species-specific lipoproteins and may represent potential targets for species-selective antimicrobial development.

What is the expression pattern of LolC in different growth phases of H. influenzae?

LolC expression in H. influenzae remains relatively constant throughout different growth phases, reflecting its essential role in continuous lipoprotein trafficking required for membrane integrity and function. As a component of the fundamental lipoprotein transport machinery, LolC expression is maintained even during stationary phase, unlike many non-essential proteins that show reduced expression during nutrient limitation . This consistent expression pattern underscores the critical nature of lipoprotein transport for bacterial survival regardless of growth conditions. Researchers may observe subtle variations in expression levels in response to specific environmental stressors that affect membrane composition requirements.

What are the structural determinants of substrate specificity in H. influenzae LolC?

The substrate specificity of H. influenzae LolC is determined by several structural features, particularly within its periplasmic domains that recognize the acyl chains and sorting signals of lipoproteins. Key amino acid residues in the substrate-binding pocket form a hydrophobic groove that accommodates the lipid moieties of lipoproteins . Specific conserved residues, likely in transmembrane helices and periplasmic loops, contribute to the selective recognition of outer membrane-destined lipoproteins. Advanced structural studies using X-ray crystallography or cryo-electron microscopy would be necessary to fully characterize these interaction sites. Researchers investigating substrate specificity should focus on the periplasmic domains and consider site-directed mutagenesis approaches to identify critical residues involved in lipoprotein recognition.

How does ATP hydrolysis by the LolD subunit couple with conformational changes in LolC to drive lipoprotein transport?

ATP hydrolysis by the LolD subunit drives conformational changes in the transmembrane subunits LolC and LolE, facilitating lipoprotein transfer to the periplasmic chaperone LolA. This energy-dependent process involves a series of coordinated structural rearrangements: (1) ATP binding to LolD induces a closed conformation that brings transmembrane domains closer; (2) hydrolysis triggers exposure of the lipoprotein binding site; (3) subsequent release of ADP and Pi resets the complex to its resting state . Researchers should employ techniques such as FRET (Förster Resonance Energy Transfer) or EPR (Electron Paramagnetic Resonance) spectroscopy to monitor these conformational changes in real-time. A detailed understanding of this coupling mechanism could reveal rate-limiting steps and potential intervention points for inhibitor development.

What are the implications of LolC mutations for antibiotic resistance in clinical isolates of H. influenzae?

Mutations in the lolC gene of H. influenzae can potentially contribute to antibiotic resistance through multiple mechanisms: (1) alterations in membrane permeability due to disrupted lipoprotein localization; (2) modified drug efflux capabilities; (3) changes in cell surface properties affecting antibiotic penetration . Clinical isolates with LolC mutations may exhibit resistance to certain antibiotics that target the cell envelope or depend on specific membrane properties for their activity. Researchers investigating these connections should sequence lolC from resistant clinical isolates and conduct complementation studies to establish direct causality between specific mutations and resistance phenotypes. Comprehensive analysis of membrane composition and permeability in these mutants would provide further insights into the underlying mechanisms.

What are the optimal expression systems for producing functional recombinant H. influenzae LolC protein?

For optimal expression of functional recombinant H. influenzae LolC protein, several expression systems have been evaluated, with cell-free expression systems and E. coli-based systems showing the highest success rates. The table below compares key parameters across different expression platforms:

Expression SystemYieldFunctional ActivityPurification ComplexityMembrane Integration
E. coliHighModerate-HighModerateRequires optimization
YeastModerateHighHighGood
BaculovirusHighHighHighVery good
Mammalian CellLowVery highHighExcellent
Cell-FreeModerateModerateLowRequires reconstitution

For functional studies, E. coli expression with membrane-targeting sequences and detergent solubilization has proven effective . When higher purity is required, cell-free expression followed by direct reconstitution into liposomes or nanodiscs provides proteins with ≥85% purity as determined by SDS-PAGE. Researchers should select expression systems based on their specific experimental requirements, with E. coli systems being most suitable for structural studies requiring large protein quantities, while mammalian systems may be preferable for functional assays requiring native-like membrane environments.

How can researchers effectively reconstitute purified LolC into membrane mimetics for functional studies?

Effective reconstitution of purified LolC into membrane mimetics requires a strategic approach to maintain protein stability and functionality. The recommended protocol involves:

  • Solubilization: Extract purified LolC (≥85% purity) using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) at concentrations just above their critical micelle concentration .

  • Membrane mimetic selection: Choose between:

    • Liposomes (E. coli lipid extract with 1-2% PG) for transport assays

    • Nanodiscs (MSP1D1 scaffold with POPC:POPG lipids) for structural studies

    • Amphipols (A8-35) for enhanced stability during cryo-EM analysis

  • Reconstitution: Remove detergent gradually using:

    • Bio-Beads for liposome reconstitution (12-hour incubation at 4°C)

    • Controlled dialysis for nanodisc assembly (detergent removal rate of 10% per hour)

  • Validation: Assess functional reconstitution through:

    • Proteoliposome floatation assays to confirm membrane integration

    • ATPase activity measurements in reconstituted LolCDE complexes

    • Binding assays with fluorescently labeled lipoprotein substrates

This methodical approach ensures functional reconstitution while preventing protein aggregation, enabling reliable downstream functional and structural analyses.

What assays can be used to quantitatively measure LolC-dependent lipoprotein transport activity?

Quantitative measurement of LolC-dependent lipoprotein transport activity can be achieved through several complementary assays that assess different aspects of the transport process:

  • In vitro reconstituted transport assay: Using proteoliposomes containing reconstituted LolCDE complex, measure the ATP-dependent transfer of fluorescently labeled lipoproteins to purified LolA. This can be quantified through FRET-based measurements or by separating proteoliposomes from soluble LolA-lipoprotein complexes via ultracentrifugation .

  • Surface plasmon resonance (SPR): Immobilize LolC or LolCDE complex on a sensor chip and measure binding kinetics and affinities for lipoproteins and/or LolA, enabling calculation of association and dissociation constants.

  • ATPase activity coupling: Measure ATP hydrolysis rates in the presence of varying concentrations of lipoprotein substrates using colorimetric phosphate detection assays. The coupling efficiency between ATP hydrolysis and transport can be calculated by comparing ATPase rates with transport rates.

  • Fluorescence anisotropy: Monitor changes in the rotational diffusion of fluorescently labeled lipoproteins as they transition from the LolCDE complex to LolA, providing real-time kinetic data on the transfer process.

  • Chemical cross-linking coupled with mass spectrometry: Identify interaction interfaces between LolC and its substrates or partner proteins, providing insights into the molecular mechanism of transport.

These assays can be combined to establish comprehensive structure-function relationships and evaluate the impact of mutations or inhibitors on transport activity.

How should researchers interpret discrepancies between in vitro and in vivo studies of H. influenzae LolC function?

When interpreting discrepancies between in vitro and in vivo studies of H. influenzae LolC function, researchers should consider several potential sources of variation:

  • Membrane environment differences: The artificial membrane compositions used in vitro may lack specific lipids or membrane proteins present in the native H. influenzae membrane that modulate LolC activity . Compare results from reconstitution experiments using synthetic lipid mixtures versus E. coli or H. influenzae total lipid extracts.

  • Complex formation considerations: In vivo, LolC functions as part of the LolCDE complex and interacts with other Lol pathway components. Isolated LolC in vitro may exhibit altered substrate specificity or activity levels. Consider performing experiments with reconstituted LolCDE complexes rather than isolated LolC.

  • Substrate variations: Natural lipoproteins in vivo contain diverse signal sequences and lipid modifications that may not be fully replicated in model substrates used for in vitro studies. Validate findings using multiple lipoprotein substrates.

  • Cellular regulation factors: Post-translational modifications, protein-protein interactions, or metabolic regulation present in vivo may be absent in purified systems. Supplement in vitro systems with cellular extracts to test for regulatory factors.

  • Experimental conditions: Differences in pH, ionic strength, and temperature between in vitro systems and the H. influenzae periplasmic environment can affect protein conformation and activity.

When discrepancies arise, researchers should systematically investigate these factors and consider the development of more sophisticated in vitro systems that better mimic the native environment of LolC function.

What statistical approaches are most appropriate for analyzing LolC substrate specificity data?

The analysis of LolC substrate specificity data requires robust statistical approaches appropriate for multivariate biochemical datasets. The following statistical methods are recommended:

  • Multiple linear regression analysis: For examining relationships between multiple lipoprotein features (acyl chain length, charge distribution, size) and binding affinity to LolC. This approach allows researchers to determine which structural features contribute most significantly to substrate recognition .

  • Principal Component Analysis (PCA): To reduce the dimensionality of large datasets comparing multiple lipoproteins across various binding parameters, helping to identify patterns and clusters of substrates with similar recognition profiles.

  • Hierarchical clustering: For grouping lipoproteins based on their interaction patterns with wild-type and mutant LolC proteins, revealing potential substrate classes.

  • Two-way ANOVA: When examining how multiple factors (e.g., temperature, pH, lipid composition) simultaneously affect LolC-substrate interactions, with appropriate post-hoc tests (Tukey's HSD) for multiple comparisons.

  • Non-linear regression analysis: For kinetic data fitting when characterizing substrate binding and release, particularly for determining KD, Kcat, and Km values that may not follow simple Michaelis-Menten kinetics.

How can researchers distinguish between direct and indirect effects when studying LolC inhibition?

Distinguishing between direct and indirect effects in LolC inhibition studies requires a systematic approach combining multiple experimental strategies:

  • Direct binding assays: Employ biophysical techniques such as isothermal titration calorimetry (ITC), microscale thermophoresis (MST), or surface plasmon resonance (SPR) to demonstrate direct binding of inhibitors to purified LolC protein . Calculate binding constants and compare with functional inhibition parameters.

  • Structure-activity relationship (SAR) studies: Synthesize and test structural analogs of potential inhibitors, correlating chemical modifications with changes in both binding affinity and functional inhibition to establish causality.

  • Resistance mutation mapping: Identify LolC mutations that confer resistance to inhibitors and determine if these mutations cluster in potential binding sites through structural modeling. Mutations affecting direct binding sites will typically lead to increased IC50 values.

  • Competition experiments: Determine if inhibition can be reversed by increasing substrate concentration, suggesting competitive inhibition at the substrate binding site rather than allosteric effects or indirect pathways.

  • Time-course studies: Analyze the temporal relationship between inhibitor addition and functional effects. Direct inhibition typically shows immediate effects, while indirect mechanisms may exhibit delayed responses.

  • Selective reconstitution: Test inhibitors in minimal reconstituted systems containing only LolC or the LolCDE complex to eliminate indirect effects mediated by other cellular components.

By integrating data from these complementary approaches, researchers can confidently distinguish between inhibitors that directly target LolC function and those that act through indirect cellular pathways.

What are the most promising approaches for targeting H. influenzae LolC in antimicrobial development?

Several promising approaches for targeting H. influenzae LolC in antimicrobial development warrant further exploration:

  • Structure-based drug design: Using resolved crystal structures or homology models of H. influenzae LolC to identify unique binding pockets that can be targeted by small molecule inhibitors, particularly focusing on regions that differ from human membrane proteins to ensure selectivity .

  • Peptidomimetic inhibitors: Developing synthetic peptides that mimic lipoprotein sorting signals recognized by LolC but act as competitive inhibitors by binding without being transported, thus blocking essential lipoprotein trafficking.

  • Allosteric modulators: Identifying compounds that bind to non-substrate sites on LolC to induce conformational changes that prevent normal function, potentially overcoming resistance mechanisms that might emerge against active site inhibitors.

  • LolC-LolA interface disruptors: Designing molecules that specifically interrupt the protein-protein interactions between LolC and the periplasmic chaperone LolA, thus preventing the critical handoff of lipoproteins in the transport pathway.

  • Combination approaches: Developing dual-action compounds that simultaneously target LolC and other components of bacterial membrane biogenesis to create synergistic effects and reduce the emergence of resistance.

These approaches should be pursued with consideration of pharmacokinetic properties relevant to respiratory tract infections, where H. influenzae typically resides, including tissue penetration and biofilm diffusion capabilities.

How might systems biology approaches enhance our understanding of LolC function in H. influenzae pathogenesis?

Systems biology approaches can significantly enhance our understanding of LolC function in H. influenzae pathogenesis through multi-omics integration and network analysis:

  • Interactome mapping: Comprehensive protein-protein interaction studies using techniques such as BioID or APEX proximity labeling to identify the full complement of proteins that interact with LolC during infection, revealing unexpected connections to virulence pathways .

  • Conditional essentiality screening: Genome-wide CRISPR interference or transposon mutagenesis screens under various infection-relevant conditions to identify genes that become essential only when LolC function is compromised, highlighting potential combination therapeutic targets.

  • Multi-omics integration: Parallel analysis of transcriptomics, proteomics, and lipidomics data from LolC-depleted H. influenzae to construct comprehensive regulatory networks governing membrane adaptation responses during infection.

  • Host-pathogen interface modeling: Computational models integrating bacterial membrane composition data (dependent on LolC function) with host immune recognition patterns to predict how altered lipoprotein localization affects immune evasion and persistence.

  • Temporal dynamics analysis: Time-resolved studies of membrane proteome changes during infection progression, correlating LolC activity levels with specific phases of pathogenesis such as adhesion, invasion, or biofilm formation.

These systems-level approaches will provide a holistic view of how LolC functions within the broader context of bacterial adaptation during infection, potentially revealing non-obvious intervention points for therapeutic development.

What are the challenges and opportunities in developing LolC-based vaccines against H. influenzae?

The development of LolC-based vaccines against H. influenzae presents both significant challenges and promising opportunities:

Challenges:

  • Limited surface accessibility: As a transmembrane protein, portions of LolC are embedded in the membrane and may have limited exposure to antibodies, potentially reducing immunogenicity of the native protein .

  • Antigenic variation: Sequence variations in LolC across different H. influenzae strains could affect cross-protection, necessitating careful epitope selection focused on conserved regions.

  • Functional constraints: The essential nature of LolC means its functional domains are likely conserved and may have structural similarities to human proteins, raising concerns about potential autoimmunity if not carefully designed.

  • Formulation complexity: Maintaining the native conformation of membrane protein antigens during vaccine production and storage represents a significant technical challenge.

Opportunities:

  • Conserved periplasmic domains: The periplasmic domains of LolC contain regions that are both highly conserved and specific to bacterial species, making them promising targets for broadly protective vaccine development.

  • Essential function: Antibodies targeting functional regions of LolC might directly interfere with lipoprotein transport, adding a functional inhibition mechanism beyond opsonization.

  • Combination approaches: LolC epitopes could be combined with other H. influenzae antigens in multi-epitope vaccines to enhance protection breadth and reduce escape mutation potential.

  • Novel delivery systems: Emerging technologies such as outer membrane vesicles or liposome-based delivery systems may better present LolC in its native conformation, enhancing the generation of functionally neutralizing antibodies.

Researchers pursuing LolC-based vaccine development should focus on identifying surface-exposed, conserved epitopes and employing structural vaccinology approaches to optimize antigen design and presentation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.