Recombinant Haemophilus influenzae Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Haemophilus influenzae Lipoprotein Signal Peptidase (LspA) is an enzyme critical for bacterial lipoprotein maturation. It plays a pivotal role in processing lipoproteins by cleaving signal peptides, thereby enabling proper anchoring of lipoproteins to the bacterial membrane. This enzymatic activity is essential for the survival and virulence of Gram-negative bacteria, including Haemophilus influenzae. LspA is also a target for antibiotic development due to its conserved nature and essential function in bacterial physiology.

Structure and Function

2.1 Structural Features
The LspA enzyme belongs to the aspartyl protease family and contains a catalytic dyad composed of two aspartate residues. These residues are responsible for cleaving the signal peptide at the lipobox motif, which typically contains a conserved sequence (-3A, -2S, -1C*) where C* represents a diacylglyceryl-modified cysteine. The enzyme's structure includes:

  • Transmembrane helices that anchor it to the bacterial membrane.

  • A β-cradle domain that accommodates the substrate peptide during cleavage .

2.2 Mechanism of Action
The cleavage process involves recognition of the lipobox motif and subsequent removal of the signal peptide, generating mature lipoproteins. These lipoproteins are then anchored to the membrane via diacylglycerol modifications, facilitating their biological roles in nutrient acquisition, signaling, and immune evasion .

Role in Bacterial Physiology

3.1 Essentiality in Gram-Negative Bacteria
LspA is indispensable for Gram-negative bacteria such as Haemophilus influenzae and Escherichia coli. Its absence leads to defective lipoprotein maturation, impairing bacterial growth and survival .

3.2 Virulence Factor
In pathogenic bacteria like Haemophilus influenzae, LspA contributes to virulence by enabling proper functioning of lipoproteins involved in host interaction and immune evasion .

Antibiotic Target Potential

4.1 Inhibition by Globomycin
Globomycin is a cyclic depsipeptide that inhibits LspA by mimicking the lipobox motif and blocking its catalytic site. This inhibition disrupts lipoprotein maturation, rendering bacteria more susceptible to immune clearance and antibiotics .

4.2 Drug Development Implications
The structural conservation of LspA across bacterial species makes it an attractive target for broad-spectrum antibiotics. Inhibitors like globomycin have demonstrated efficacy against methicillin-resistant Staphylococcus aureus (MRSA) and other Gram-positive pathogens, highlighting its therapeutic potential .

Research Findings

5.1 Genetic Studies
Mutants lacking LspA show reduced virulence in infection models, confirming its role in bacterial pathogenicity . Complementation studies have restored LspA function, further validating its essentiality.

5.2 Structural Analysis
High-resolution structures of LspA have elucidated its substrate-binding pocket and catalytic mechanism, providing insights into inhibitor design .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please specify this requirement during order placement. We will then prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
lspA; CGSHiGG_08630; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-171
Protein Length
full length protein
Species
Haemophilus influenzae (strain PittGG)
Target Names
lspA
Target Protein Sequence
MSKKSGLSFLWLSAVAFVVDLLTKYIVVQKFDLYESVNVLPVFNLTYVRNYGAAFSFLAD HSGWQQYFFILLALAISGMLVYFLAKNNAEQKIQNSAYALIIGGALANMVDRAYNGFVVD FFDFYWDIYHYPVFNIADIAICIGAGLLALDAFKSEKKKVQDKQVEKCGQK
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is lipoprotein signal peptidase (LspA) and what is its primary function?

LspA is an aspartyl protease responsible for cleaving the transmembrane helix signal peptide of lipoproteins during the lipoprotein processing pathway. This enzyme plays a crucial role in the maturation of bacterial lipoproteins by performing the second step in the lipoprotein processing pathway. In Haemophilus influenzae, which commonly inhabits the upper respiratory tract and can cause serious mucosal infections, LspA is involved in processing surface-localized lipoproteins that contribute to the bacterium's pathogenicity . The enzyme contains a catalytic dyad of aspartic acid residues that are highly conserved and essential for its proteolytic activity .

Why is LspA considered a potential target for antibiotic development?

LspA represents an excellent target for antibiotic development for several compelling reasons. First, it is essential in Gram-negative bacteria such as H. influenzae, E. coli, and P. aeruginosa, meaning these organisms cannot survive without functional LspA . Second, while not essential in Gram-positive bacteria like S. aureus, LspA significantly contributes to virulence in these organisms, as demonstrated by reduced survival of LspA-deficient MRSA mutants in human blood . Third, the high conservation of residues surrounding the active site suggests that resistance mutations that would impede antibiotic binding would likely also interfere with substrate binding and cleavage, potentially reducing the development of antibiotic resistance . These characteristics collectively make LspA an attractive target for developing new antimicrobial strategies.

How does the structure of LspA facilitate its enzymatic function?

The structural architecture of LspA is specifically adapted to its membrane-embedded function. The enzyme features a β-cradle and a highly conserved periplasmic helix (PH) that work together to "clamp" the substrate in place . MD simulations and EPR studies reveal that LspA exhibits significant conformational dynamics, particularly in the periplasmic helix which fluctuates on the nanosecond timescale. In its apo (unbound) state, LspA predominantly adopts a closed conformation where the PH occludes the charged active site from the lipid bilayer . This conformational flexibility explains how LspA can accommodate and process a variety of different substrates with varying sequences and structures. The enzyme samples multiple conformations, including closed, intermediate, and open states, with the population of each state varying depending on whether it is in an apo or antibiotic-bound condition .

What conformational dynamics of LspA are critical for its function?

The conformational dynamics of LspA play a crucial role in substrate binding and catalysis. According to molecular dynamics simulations and electron paramagnetic resonance studies, the periplasmic helix (PH) of LspA fluctuates on the nanosecond timescale, sampling three main conformations: closed, intermediate, and open . In the most closed conformation, the β-cradle and PH are only 6.2 Å apart, completely occluding the charged and polar active site residues from the lipid bilayer environment . This conformation likely protects the hydrophilic active site in the absence of substrate.

The intermediate conformation, which is more populated in the globomycin-bound state, may represent a state that is primed for substrate binding. The most open conformation, which creates a trigonal cavity, is the only configuration that would sterically allow the prolipoprotein substrate to enter and bind in the correct orientation for signal peptide cleavage . This conformational plasticity is essential for LspA's ability to process various substrates and explains the enzyme's functional versatility. The observation that LspA samples all three conformations in different states (apo, globomycin-bound, and myxovirescin-bound) but with varying populations in each state provides important insights for rational drug design targeting specific conformations .

How do mutations in conserved regions affect LspA activity and antibiotic sensitivity?

Site-directed mutagenesis studies of LspA from S. aureus (LspMrs) have revealed the critical importance of several conserved residues for enzymatic activity and antibiotic sensitivity. As shown in Table 1 from the research data, mutations in highly conserved residues dramatically affect both enzyme activity and susceptibility to antibiotics like globomycin and myxovirescin :

ConstructRelative activity (%)IC50 (μM) GlobomycinIC50 (μM) Myxovirescin
LspPae WT1330.64 ± 0.161.09 ± 0.34
LspMrs WT100170.7 ± 0.640.16 ± 0.00
N52A71.23 ± 0.59
N52Q712.43 ± 0.340.29 ± 0.08
G54A1131.78 ± 0.250.57 ± 0.01
G54P0NDND
R110A0NDND
R110K501.73 ± 0.100.40 ± 0.03
D118N0NDND
N133A3NDND
N133Q3NDND

Notably, mutations N52A, G54P, R110A, D118N, N133A, and N133Q drastically reduce or completely abolish enzyme activity . The conservative substitution R110K retains 50% activity, suggesting the importance of a positive charge at this position. Interestingly, mutations that retain some activity often show altered sensitivity to antibiotics, as evidenced by the changes in IC50 values. These structure-function relationships provide valuable insights for understanding the catalytic mechanism of LspA and for the rational design of novel inhibitors targeting specific residues or conformations .

What is the relationship between antibiotic binding and LspA conformational states?

Antibiotic binding to LspA induces specific conformational changes that inhibit the enzyme's function. When globomycin binds to LspA, it stabilizes an intermediate conformation of the periplasmic helix that inhibits both signal peptide cleavage and substrate binding . EPR studies and crystallographic analyses reveal that globomycin-bound LspA shows multiple binding modes with the dominant conformation of the periplasmic helix in a more open position compared to the apo state .

This antibiotic-induced stabilization of specific conformations explains the mechanism of inhibition: by locking the enzyme in conformations that are incompatible with substrate binding or catalysis. The difference in binding profiles between globomycin and myxovirescin also demonstrates that different antibiotics can interact with LspA through distinct mechanisms, though both maintain similar interactions with the catalytic diad . This conformational plasticity in antibiotic binding provides multiple avenues for developing new inhibitors that may target different conformational states of the enzyme, potentially addressing the challenge of antibiotic resistance .

What recombinant strategies are most effective for producing functional H. influenzae LspA?

The production of recombinant H. influenzae LspA presents unique challenges due to its membrane-embedded nature and N-terminal lipid modifications. Traditional purification has been hampered by these lipid modifications. An effective strategy involves replacing the N-terminal lipid modification signal sequence with one for protein secretion without such modification, while simultaneously placing expression under the control of a T7-inducible promoter . This approach enables high levels of phosphomonoesterase activity after IPTG induction.

After expression, a two-step chromatography purification process can yield apparently homogeneous protein . The removal of the N-terminal lipid modification facilitates easier extraction of the recombinant enzyme from the bacterial membrane and allows it to partition within the matrix of gel filtration chromatography resin while maintaining a denatured molecular weight similar to that of wild-type protein . Importantly, the recombinant protein retains properties similar to the wild-type protein in terms of SDS-PAGE-derived molecular weight, primary structure, substrate specificity, pH optimum, and sensitivity or resistance to various inhibitors, confirming its functional relevance .

How can molecular dynamics simulations and EPR studies be combined to elucidate LspA function?

A hybrid experimental approach combining molecular dynamics (MD) simulations and electron paramagnetic resonance (EPR) studies has proven highly effective for elucidating the conformational dynamics of LspA. This combined methodology overcomes the limitations of each individual approach and provides a more comprehensive understanding of the enzyme's function .

For MD simulations, researchers have successfully employed the GROMACS software with the Martini 2.2 force field to run initial coarse-grained simulations, allowing for the assembly and equilibration of a lipid bilayer around LspA . These simulations typically begin with a known crystal structure (such as PDB: 5DIR) and apply an elastic network between backbone beads. The systems are first energy minimized using steepest descent algorithm and then simulated while maintaining constant temperature and pressure .

For EPR studies, both continuous wave (CW) and double electron-electron resonance (DEER) techniques have been utilized to analyze the conformational states of LspA. The CW technique provides information about nanosecond timescale dynamics, while DEER measurements reveal distance distributions between specific sites in the protein labeled with spin probes .

The true power of this hybrid approach lies in the validation and cross-correlation of findings. Structures derived from MD simulations can be validated against experimental DEER distance distributions, ensuring that the computational models accurately reflect the protein's behavior in a membrane environment . This integrated methodology has successfully identified conformational states of LspA not previously observed in crystal structures, providing crucial insights for antibiotic development .

What are effective approaches for evaluating the importance of LspA in bacterial virulence?

Evaluating the role of LspA in bacterial virulence requires multiple complementary approaches spanning in vitro, ex vivo, and in vivo methodologies. For Gram-positive bacteria like S. aureus, where LspA is not essential for growth, genetic knockout studies provide valuable insights. Researchers have successfully generated LspA-deficient mutants (ΔlspA) through standard genetic techniques and confirmed that these mutants grow similarly to wild-type strains in rich laboratory media, indicating that loss of LspA activity does not affect basic bacterial growth in vitro .

Ex vivo infection models using human blood have proven particularly informative. By comparing the survival of wild-type and ΔlspA mutant strains in whole human blood, researchers have demonstrated that LspA activity is important for MRSA survival during human infection . The inclusion of appropriate controls, such as testing the same strains in fresh plasma from the same blood donors, helps distinguish between reduced ability to survive killing by phagocytes versus general growth defects .

Complementation studies, where the mutant strain is transformed with a plasmid expressing functional LspA (e.g., LAC lspA (pALC2073::lspA)), serve as critical controls to confirm that the observed phenotypes are specifically due to the absence of LspA rather than polar effects or secondary mutations . Additionally, mouse models of infection and bacteremia have been employed to assess the in vivo relevance of LspA for virulence, with signature-tagged mutagenesis screens providing further evidence of LspA's importance in pathogenesis .

How does the β-cradle and periplasmic helix contribute to substrate recognition?

The β-cradle and periplasmic helix (PH) of LspA form a critical structural feature that mediates substrate recognition and binding. Based on crystal structures and molecular dynamics simulations, these elements act as a dynamic "clamp" that captures and positions lipoprotein substrates for catalysis . In the apo state, the predominant conformation has the PH positioned over the active site, occluding the charged catalytic dyad from the hydrophobic environment of the lipid bilayer . This closed conformation, where the β-cradle and PH are approximately 6.2 Å apart, likely serves to protect the hydrophilic active site in the absence of substrate.

For substrate binding to occur, the PH must transition to a more open conformation, creating a trigonal cavity where the lipoprotein substrate can enter . This structural flexibility is crucial for accommodating the diverse range of lipoprotein substrates that LspA processes. The intermediate conformation, which is more populated in globomycin-bound states, may represent a transitional state between substrate recognition and catalysis .

Importantly, the conformational dynamics of the β-cradle and PH occur on the nanosecond timescale, as demonstrated by continuous wave electron paramagnetic resonance (CW EPR) studies . This rapid sampling of different conformations facilitates the enzyme's ability to recognize and bind various substrates while maintaining specificity for the lipoprotein signal peptide region. Understanding these structure-function relationships provides valuable insights for the design of inhibitors that could target specific conformational states of the enzyme.

What insights have site-directed mutagenesis studies provided about LspA catalytic mechanism?

Site-directed mutagenesis studies have yielded crucial insights into the catalytic mechanism of LspA and the roles of specific conserved residues. As detailed in experimental data, mutations in several highly conserved residues dramatically affect enzyme activity . The complete loss of activity in the D118N mutant confirms the essential role of this aspartic acid residue in the catalytic dyad, consistent with LspA functioning as an aspartyl protease .

Similarly, the R110A mutation results in complete loss of activity, while the more conservative R110K substitution retains 50% activity, indicating that a positive charge at this position is crucial for function . The asparagine at position 133 appears to be absolutely required, as both N133A and N133Q mutations reduce activity to just 3% of wild-type levels .

These mutagenesis studies not only identify critical residues for catalysis but also provide insights into potential mechanistic details. The pattern of sensitivity to conservative versus non-conservative substitutions helps map the functional groups and structural features essential for substrate binding and catalysis, guiding rational approaches to inhibitor design.

How does LspA inhibition compare between different antibiotics like globomycin and myxovirescin?

Comparative studies of LspA inhibition by different antibiotics reveal distinct inhibitory profiles and mechanisms. Globomycin and myxovirescin, two antibiotics that target LspA, show markedly different IC50 values depending on the bacterial species origin of the enzyme. For instance, LspA from S. aureus (LspMrs) shows an IC50 of 170.7 ± 0.64 μM for globomycin but only 0.16 ± 0.00 μM for myxovirescin, indicating a significantly higher sensitivity to myxovirescin . In contrast, LspA from P. aeruginosa (LspPae) exhibits similar sensitivity to both antibiotics, with IC50 values of 0.64 ± 0.16 μM for globomycin and 1.09 ± 0.34 μM for myxovirescin .

These differential sensitivities likely reflect structural variations in the antibiotic binding sites between LspA enzymes from different bacteria. Mutations in LspA can significantly alter these inhibition profiles. For example, the N52A mutation in LspMrs dramatically increases sensitivity to globomycin (IC50 reduced from 170.7 to 1.23 μM) while potentially eliminating inhibition by myxovirescin . Similarly, the G54A mutation increases globomycin sensitivity and reduces myxovirescin sensitivity .

At the molecular level, structural and conformational dynamics studies indicate that while both antibiotics interact with the catalytic dyad, they stabilize different conformations of the enzyme . Globomycin appears to favor an intermediate conformation of the periplasmic helix that inhibits both signal peptide cleavage and substrate binding . These insights into the distinct mechanisms of inhibition provide valuable direction for the development of new antibiotics targeting LspA through different mechanistic routes, potentially addressing challenges of antibiotic resistance.

Why is the conservation of active site residues significant for antibiotic resistance development?

The high conservation of active site residues in LspA across different bacterial species has profound implications for antibiotic resistance development. The catalytic dyad and fourteen additional highly conserved residues surrounding the active site have been identified as crucial for enzyme function . This extensive conservation suggests evolutionary constraints on these residues due to their essential roles in substrate binding and catalysis.

From an antibiotic development perspective, this conservation presents a significant advantage. Resistance mutations that would alter the active site to impede antibiotic binding would also likely interfere with the binding and cleavage of the natural lipoprotein substrates . This creates a high barrier to resistance development, as mutations conferring resistance might simultaneously compromise the essential function of the enzyme.

This characteristic makes LspA a particularly powerful target to combat the development of antibiotic resistance . Unlike some other antibiotic targets where resistance can emerge through point mutations that specifically affect drug binding without compromising protein function, the dual role of LspA's conserved residues in both substrate processing and antibiotic interaction makes such selective mutations less likely to succeed.

The understanding of this conservation-based resistance barrier provides an important criterion for antibiotic development efforts targeting LspA. Designing inhibitors that specifically interact with these highly conserved residues could potentially create antibiotics with a reduced risk of resistance development, addressing one of the most significant challenges in contemporary antimicrobial therapy.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.