Recombinant Haemophilus influenzae Molybdenum transport system permease protein modB (modB)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Purification

Recombinant ModB is engineered for overexpression in heterologous systems like Escherichia coli or yeast. Key steps and characteristics include:

Table 1: Recombinant ModB Production Details

Host SystemPurityMolecular WeightGene SourceKey Features
E. coli≥85%~35 kDaH. influenzae modBMembrane-extracted, retains activity
Yeast≥85%~35 kDaH. influenzae modBSoluble with N-terminal secretion tag
Mammalian Cells≥85%~35 kDaH. influenzae modBPost-translational modifications

Data derived from expression studies .

  • Purification: Achieved via affinity chromatography (e.g., His-tag systems) and gel filtration, yielding ≥85% purity as confirmed by SDS-PAGE .

  • Functional Validation: Retains substrate-binding specificity and ATPase-coupled transport activity comparable to wild-type protein .

3.1. Dual Molybdate Transport Systems

H. influenzae employs two distinct molybdate transporters:

  1. High-Affinity Mod System: Regulated by cytoplasmic molybdate sensors like ModE .

  2. Low-Affinity ModABC System: Mediates uptake under high extracellular molybdate concentrations, with ModB as the permease .

3.3. Role in Bacterial Physiology

  • Essential for Virulence: Molybdenum-dependent enzymes (e.g., nitrate reductases) are critical for H. influenzae survival in host environments .

  • Cross-Regulation: The ModABC system is repressed under low molybdate conditions, prioritizing the high-affinity transporter .

Applications and Future Directions

  • Biotechnological Use: Recombinant ModB aids in structural studies (e.g., cryo-EM) to resolve transporter dynamics .

  • Therapeutic Targeting: Inhibiting ModB could disrupt molybdenum homeostasis in pathogenic H. influenzae strains .

Open Questions

  • How does ModB coordinate with ModA/C during the transport cycle?

  • Does ModB interact with other metal transporters in H. influenzae?

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
modB; HI_1692; Molybdenum transport system permease protein ModB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
modB
Target Protein Sequence
MEISAINLSLSVAVSSMLWSLPLAIFVAWLLARKNFYGKSLITGVIHLPLVLPPVVIGYL LLVAMGRNGFIGKYLYQWFGLSFGFSWKGAVLSSAVVAFPLVVRAIRLSLENIDIKLEQA AQTLGASAWRVFFTITLPLSLPGVLAGLVLGFARSLGEFGATITFVSNIAGETQTIPLAM YSFIQTPGAEEQTARLCLFAIILSLISLLLSEWLSKRMQKKLGQGNVAD
Uniprot No.

Target Background

Function
This protein is part of the binding-protein-dependent transport system for molybdenum. It is likely responsible for the translocation of the substrate across the membrane.
Database Links

KEGG: hin:HI1692

STRING: 71421.HI1692

Protein Families
Binding-protein-dependent transport system permease family, CysTW subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of ModB in Haemophilus influenzae?

ModB functions as an integral membrane permease protein component of the ATP-binding cassette (ABC) transporter system for molybdate in H. influenzae. As part of the ModABC transport system, ModB forms the transmembrane channel through which molybdate ions are transported into the bacterial cell. This protein works in conjunction with ModA (the periplasmic binding protein) and ModC (the ATP-binding protein) to facilitate the energy-dependent uptake of molybdate, which is essential for various metabolic processes in the bacterium .

How is the modB gene organized within the H. influenzae genome?

The modB gene is part of the modABCD operon in H. influenzae, which encodes the complete molybdate transport system. This operon structure is similar to that found in other bacteria such as E. coli. The genes in this operon are arranged sequentially, with modA encoding the periplasmic molybdate-binding protein, modB encoding the transmembrane permease, modC encoding the ATP-binding component, and modD encoding a protein of related function . The organization of this operon reflects the coordinated expression of these proteins that function together in the transport process.

What is the relationship between ModB and other components of the molybdate transport system?

ModB works in close association with ModA and ModC to form a functional molybdate transport complex. ModA (the periplasmic binding protein) captures molybdate in the periplasmic space and delivers it to the ModB permease channel . The ModB protein typically functions as a dimer (ModB₂) in the inner membrane, forming the channel through which molybdate passes. ModC provides the energy for this transport through ATP hydrolysis. In H. influenzae, there appears to be a system similar to the MolB₂C₂ transporter (formerly designated HI1470/71) that works with MolA, suggesting potential structural and functional parallels between the Mod and Mol systems .

How do mutations in modB affect molybdate transport efficiency in H. influenzae?

Mutations in the modB gene can significantly impair molybdate transport efficiency in H. influenzae. Research has shown that mod mutations decrease the rate of molybdate transport and its accumulation by bacterial cells . The specific impact depends on the nature and location of the mutation within the modB sequence. Mutations affecting the transmembrane domains may disrupt the channel structure, while those affecting interaction sites with ModA or ModC may impair the coordinated function of the transport complex. Complementation studies with wild-type modB can restore transport function, confirming the essential role of this protein in the process .

What are the structural characteristics of ModB that enable specific molybdate transport?

The ModB protein contains multiple transmembrane domains that form a specific channel for molybdate ions. While the exact structure of H. influenzae ModB has not been fully characterized in the provided search results, related ABC transporters suggest that ModB likely contains 5-6 transmembrane α-helices per monomer, with the functional unit being a dimer (ModB₂). The channel formed by this dimer contains specific residues that interact with molybdate, providing selectivity for this ion over other similar oxyanions like sulfate or phosphate. This selectivity parallels that observed in the periplasmic binding protein MolA, which binds molybdate and tungstate but not sulfate or phosphate .

How does the affinity of the ModABC transport system compare with other molybdate transport systems in H. influenzae?

H. influenzae appears to possess multiple transport systems for molybdate, suggesting differential affinity and roles in bacterial physiology. The search results indicate that H. influenzae contains at least two molybdate loci, with the MolABC system functioning as a low-affinity molybdate transporter . The MolA-binding protein has been shown to have a binding affinity of approximately 100 μM for tungstate and molybdate, which is significantly lower than the affinity observed for class II ModA molybdate-binding proteins that have nanomolar to low micromolar affinity for molybdate . This suggests a complementary system where ModABC might function as a high-affinity transporter while MolABC serves as a low-affinity system, allowing the bacterium to respond to varying environmental molybdate concentrations.

What are the optimal expression systems for producing recombinant H. influenzae ModB protein?

For recombinant expression of H. influenzae ModB, E. coli-based expression systems are typically preferred due to their ease of genetic manipulation and culture. When expressing membrane proteins like ModB, specialized E. coli strains such as C41(DE3) or C43(DE3), which are designed for toxic or membrane protein expression, often yield better results. Expression vectors containing inducible promoters (such as T7 or araBAD) allow for controlled expression, which is crucial for membrane proteins that can be toxic when overexpressed.

For purification purposes, ModB can be tagged with affinity tags such as His6 or FLAG at either the N- or C-terminus, though care must be taken to ensure the tag doesn't interfere with protein folding or function. Expression should be conducted at lower temperatures (16-25°C) to facilitate proper folding of the membrane protein. Extraction requires appropriate detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) to solubilize the protein from the membrane while maintaining its native conformation.

What methodologies are effective for studying ModB-substrate interactions?

Several complementary approaches can be employed to study ModB-substrate interactions:

  • Isothermal Titration Calorimetry (ITC): This technique can measure the binding affinity between purified ModB protein (in detergent micelles or reconstituted into liposomes) and molybdate or related substrates. From the search results, we know that molybdate binding proteins in H. influenzae show differential affinities (~100 μM for MolA) , which can serve as a comparison point.

  • Fluorescence-based assays: Using fluorescently labeled substrates or fluorescent protein tags to monitor conformational changes upon substrate binding.

  • Transport assays: Reconstitution of purified ModB (along with ModA and ModC) into proteoliposomes allows for direct measurement of molybdate transport. Radioactively labeled molybdate (⁹⁹Mo) can be used to track transport rates and kinetics.

  • Site-directed mutagenesis: Systematic mutation of predicted substrate-binding residues in ModB, followed by functional assays, can identify critical amino acids involved in substrate recognition and transport.

  • Structural studies: X-ray crystallography or cryo-electron microscopy of ModB alone or in complex with ModA and ModC can provide detailed insights into the substrate transport mechanism.

How can researchers effectively generate and characterize modB mutants in H. influenzae?

To generate and characterize modB mutants in H. influenzae, researchers can employ the following methodological approach:

  • Mutant generation:

    • Site-directed mutagenesis using PCR-based methods on cloned modB

    • Natural transformation in H. influenzae using linearized DNA containing the desired mutations

    • Kanamycin resistance cassette insertions for gene disruption, similar to the approach used for mod::kan mutants described in the search results

    • MIV transformation method as described for H. influenzae in the literature

  • Confirmation of mutations:

    • PCR amplification and sequencing of the modB region

    • Southern hybridization analysis using DIG-labeled probes

    • Verification of expression changes at protein level using Western blotting

  • Functional characterization:

    • Molybdate uptake assays using radioactively labeled molybdate

    • Growth studies under conditions requiring molybdenum-dependent enzymes

    • Complementation studies with wild-type modB to confirm phenotype specificity

    • Biochemical analysis to measure changes in transport rates and molybdate accumulation

  • Comparative analysis:

    • Comparison with mod::kan mutants that have been previously characterized

    • Assessment of effects on related transport systems like the MolABC system

How is expression of modB regulated in H. influenzae?

The expression of modB in H. influenzae is likely regulated as part of the modABCD operon, responding to molybdate availability in the environment. While specific regulatory mechanisms for H. influenzae modB aren't detailed in the search results, bacterial transport systems typically employ feedback regulation based on substrate availability.

In H. influenzae, gene expression can be affected by phase variation mechanisms, as seen with the methyltransferase (Mod) associated with type III restriction-modification systems that can coordinate random switching of multiple genes . Although not directly linked to modB in the search results, such epigenetic regulation mechanisms might influence transport system expression in response to environmental conditions. Additionally, molybdate transport systems in bacteria are often regulated by molybdate-responsive transcriptional regulators that sense intracellular molybdate concentrations and adjust transporter expression accordingly.

What is the relationship between the ModABC and MolABC transport systems in H. influenzae?

H. influenzae appears to possess at least two distinct molybdate transport systems: ModABC and MolABC. Based on the search results, these systems differ in their substrate affinity characteristics:

  • MolABC system:

    • Includes MolA (HI1472), a periplasmic binding protein that delivers substrate to the MolB₂C₂ transporter (formerly HI1470/71)

    • Functions as a low-affinity molybdate transport system with ~100 μM binding affinity for tungstate and molybdate

    • Selectively binds molybdate and tungstate, but not other oxyanions such as sulfate and phosphate

    • Represents a class III molybdate-binding protein system

  • ModABC system:

    • Based on comparisons with other bacterial systems, likely functions as a higher-affinity transport system

    • Part of the modABCD operon described in the literature

The presence of multiple transport systems with different affinities suggests a complementary approach to molybdate acquisition, allowing H. influenzae to efficiently acquire this essential nutrient across varying environmental concentrations. This dual-system approach may provide a competitive advantage in the host environment where molybdate availability may fluctuate.

How might ModB be utilized as a target for antimicrobial development?

ModB and the molybdate transport system represent potential targets for antimicrobial development due to their essential role in bacterial metabolism. Several research approaches could be pursued:

  • Inhibitor design: Structure-based drug design targeting the substrate-binding site or conformational changes of ModB could yield specific inhibitors that block molybdate transport. Since molybdate is essential for various enzymatic processes, inhibiting its transport could impair bacterial viability.

  • Competitive transport: Development of toxic molybdate analogs that utilize the ModB transport pathway to enter bacterial cells but interfere with molybdate-dependent enzymes.

  • Disruption of protein-protein interactions: Targeting the interfaces between ModB and other components of the transport system (ModA and ModC) could inhibit the formation of a functional complex.

  • Advantage over human cells: Since human cells utilize different mechanisms for molybdate uptake, selective targeting of bacterial ModB may offer a therapeutic window with minimal host toxicity.

  • Combination therapy: Inhibitors of ModB could potentially sensitize H. influenzae to existing antibiotics by compromising metabolic functions and stress responses.

What are the key methodological considerations for analyzing ModB interactions with the host immune system?

Understanding how ModB might interact with the host immune system requires several methodological approaches:

  • Antigen presentation studies:

    • Recombinant ModB protein or peptide fragments can be assessed for binding to MHC molecules

    • Analysis of processing and presentation of ModB epitopes by antigen-presenting cells

    • T-cell stimulation assays to identify immunogenic regions

  • Antibody recognition:

    • ELISA and Western blot analysis using sera from patients with H. influenzae infections to detect anti-ModB antibodies

    • Epitope mapping to identify immunodominant regions of ModB

    • Assessment of antibody-mediated effects on bacterial viability and transport function

  • Innate immune interactions:

    • Investigation of potential interactions between ModB and pattern recognition receptors

    • Studies on whether ModB exposure triggers inflammatory cytokine production

    • Analysis of neutrophil and macrophage responses to ModB-expressing bacteria versus modB mutants

  • In vivo infection models:

    • Comparison of wild-type and modB mutant H. influenzae in animal infection models

    • Analysis of immune response profiles and bacterial clearance

    • Assessment of vaccine potential using recombinant ModB

What are emerging techniques for studying the structural dynamics of ModB during the transport cycle?

Several cutting-edge techniques are enabling researchers to better understand the structural dynamics of membrane transporters like ModB:

  • Cryo-electron microscopy (cryo-EM): This technique has revolutionized membrane protein structural biology, allowing visualization of conformational states without the need for crystallization. For ModB, cryo-EM could capture different conformations during the transport cycle.

  • Single-molecule FRET (smFRET): By labeling specific residues in ModB with fluorescent probes, researchers can monitor real-time conformational changes during substrate binding and transport.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can identify regions of ModB that undergo conformational changes upon substrate binding or interaction with other components of the transport system.

  • Molecular dynamics simulations: Using structural data, computational approaches can simulate ModB movement and substrate translocation through the membrane, providing insights difficult to capture experimentally.

  • Nanodiscs and lipid bilayer systems: Reconstituting ModB into lipid nanodiscs provides a more native-like environment than detergent micelles for functional and structural studies.

  • Time-resolved structural methods: Techniques like time-resolved X-ray crystallography or time-resolved cryo-EM can potentially capture transient states in the transport cycle.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.