Recombinant Haemophilus influenzae Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your required tag type for preferential development.
Synonyms
mtgA; HI_0831; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-246
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
mtgA
Target Protein Sequence
MKKTKRIFTALSHLFSPKWWKKNWQRVVFCFFFAVFALLLIFRFVPIPFSAYMVQQKIAN LLQGDFRYQIQYNWVSLENISPNIQLAVISSEDQRFLEHLGFDFEAIQRAIRYNEKSNKG IRGASTISQQTAKNLMLWHGQNWLRKGLEVPATMLLELTWSKKRILEVYLNIAEFGNGIF GVEAASRYYFKKSAKNLSQNEAALLAAVLPNPIIYKVNKPSLLVRKKQTWILRQMGNLGT EYLSHL
Uniprot No.

Target Background

Function
A peptidoglycan polymerase that catalyzes the elongation of glycan chains from lipid-linked precursors.
Database Links

KEGG: hin:HI0831

STRING: 71421.HI0831

Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • How does mtgA differ from bifunctional peptidoglycan synthases in Haemophilus influenzae?

    Unlike bifunctional peptidoglycan synthases such as PBP1A that possess both transglycosylase (TG) and transpeptidase (TP) domains, mtgA is a monofunctional enzyme that exclusively catalyzes transglycosylation reactions . In H. influenzae, peptidoglycan synthesis involves both monofunctional transglycosylases like mtgA and class A PBPs (like PBP1A) that contain both TG and TP domains.

    Research in S. aureus demonstrated that cells require at least one functional transglycosylase for survival, which can be either the bifunctional PBP2 or the monofunctional MGT . This suggests that monofunctional transglycosylases like mtgA might have partially redundant functions with the TG domains of bifunctional PBPs, providing a backup mechanism for peptidoglycan synthesis.

  • What is the genomic context of the mtgA gene in Haemophilus influenzae?

    The mtgA gene in H. influenzae encodes the monofunctional biosynthetic peptidoglycan transglycosylase. In strain KW20/Rd, the gene is designated as HI_0831 . The genomic context of mtgA is important because peptidoglycan synthesis genes are often clustered or co-regulated.

    Through genomic sequencing, H. influenzae was the first free-living organism to have its entire genome sequenced, which facilitated the identification of peptidoglycan metabolizing enzymes . This genomic information has allowed researchers to identify and characterize novel genes involved in cell wall metabolism, including transglycosylases like mtgA.

Research Applications and Advanced Techniques

  • How can mtgA be used as a target for developing novel antimicrobials against multidrug-resistant Haemophilus influenzae?

    With the increasing prevalence of multidrug-resistant H. influenzae, enzymes involved in peptidoglycan synthesis, including mtgA, represent potential targets for novel antimicrobials . Several strategies could be employed:

    a) Structure-Based Drug Design: Determining the three-dimensional structure of mtgA could facilitate the design of specific inhibitors that target its active site.

    b) High-Throughput Screening: Using recombinant mtgA in enzymatic assays to screen chemical libraries for potential inhibitors.

    c) Combination Therapy Approaches: Identifying compounds that synergize with existing antibiotics by targeting multiple steps in peptidoglycan synthesis.

    d) Peptidomimetics: Designing molecules that mimic mtgA substrates but block catalytic activity.

    Recent research has identified nearly pan-resistant lineages of H. influenzae globally, highlighting the urgent need for new antimicrobial strategies . As a conserved enzyme essential for bacterial cell wall synthesis, mtgA represents a promising target.

  • What is the role of mtgA in Haemophilus influenzae membrane vesicle formation and bacterial communication?

    Research on Pseudomonas aeruginosa has shown that peptidoglycan-modifying enzymes, including MtgA, can be selectively enriched in membrane vesicles (MVs) induced under specific conditions . While not directly studied in H. influenzae, similar mechanisms might exist.

    In P. aeruginosa, MMC-induced MVs showed a >10-fold enrichment of several peptidoglycan-modifying enzymes, including MtgA . This suggests that transglycosylases might play a role in MV formation or function.

    The presence of peptidoglycan-modifying enzymes in MVs could facilitate:

    • Cell wall remodeling during growth

    • Bacterial communication through peptidoglycan fragment release

    • Competitive interactions with other bacteria

    • Evasion of host immune responses

    Understanding mtgA's potential role in MV formation in H. influenzae could provide insights into bacterial communication and virulence mechanisms.

  • How does mtgA activity correlate with Haemophilus influenzae pathogenesis in different infection models?

    While direct evidence linking mtgA to H. influenzae pathogenesis is limited in the search results, inferences can be made based on related research:

    a) Intracellular Invasion: Studies using Transformed Recombinant Enrichment Profiling (TREP) identified the HMW1 adhesin as a crucial factor for intracellular invasion by H. influenzae . Proper cell wall synthesis, mediated in part by mtgA, likely supports the expression and function of such virulence factors.

    b) Biofilm Formation: Cell wall synthesis enzymes contribute to bacterial self-aggregation and biofilm formation, which are important for persistence during chronic infection .

    c) Immune Evasion: Alterations in peptidoglycan structure, potentially influenced by mtgA activity, can affect recognition by host immune receptors.

    d) Antibiotic Tolerance: Changes in cell wall metabolism can contribute to antibiotic tolerance in biofilms and during chronic infection.

    Research has shown that H. influenzae is a major opportunistic human pathogen causing both non-invasive and invasive disease . Understanding how mtgA contributes to cell wall synthesis during infection could provide insights into pathogenesis mechanisms.

  • What techniques are most effective for analyzing mtgA genetic variations across different Haemophilus influenzae strains?

    Several techniques can be employed to analyze genetic variations in mtgA across different H. influenzae strains:

    a) Whole-Genome Sequencing: Large-scale genomic studies have sequenced thousands of H. influenzae isolates, revealing population structure and genetic diversity . Analysis of these datasets can identify variants in mtgA and correlate them with phenotypic differences.

    b) Multilocus Sequence Typing (MLST): This approach can identify different lineages of H. influenzae and correlate mtgA variations with specific clades.

    c) Recombination Analysis: H. influenzae is naturally competent, actively taking up and recombining homologous DNA into its genome . Analyzing recombination patterns can reveal how mtgA variants spread through the population.

    d) Selection Pressure Analysis: Calculating the ratio of non-synonymous to synonymous substitutions (dN/dS) in mtgA sequences can reveal whether the gene is under positive, neutral, or negative selection.

    Recent population genetic analyses of nearly 6,000 published H. influenzae genomes revealed a highly admixed population structure, low core genome nucleotide diversity, and evidence of pervasive negative selection , suggesting that essential genes like mtgA might be under functional constraints.

  • How can recombinant mtgA be utilized in studying competence and DNA uptake mechanisms in Haemophilus influenzae?

    H. influenzae has a well-defined competence regulon induced by signals of energy and nucleotide scarcity . While mtgA is not directly part of this regulon, its role in cell wall synthesis could influence competence by affecting cell envelope properties.

    Potential research approaches include:

    a) Investigating Cell Wall Changes During Competence: Using recombinant mtgA to study how peptidoglycan structure changes during competence development.

    b) Exploring DNA Uptake Pathway Interactions: Examining whether mtgA-mediated cell wall modifications affect the function of DNA uptake machinery embedded in the cell envelope.

    c) Competence-Regulated Expression Studies: Investigating whether mtgA expression is indirectly affected by competence development.

    d) Transformation Efficiency Analysis: Determining if alterations in mtgA activity affect natural transformation efficiency.

    Research has shown that in H. influenzae, competence development is regulated by CRP and Sxy transcription factors in response to carbon source depletion and nucleotide scarcity . Understanding how cell wall dynamics, influenced by mtgA, interact with this process could provide new insights into bacterial evolution and adaptation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.