Recombinant Haemophilus influenzae Na (+)-translocating NADH-quinone reductase subunit C

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
nqrC; HI_0167; Na(+-translocating NADH-quinone reductase subunit C; Na(+-NQR subunit C; Na(+-translocating NQR subunit C; NQR complex subunit C; NQR-1 subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-244
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
nqrC
Target Protein Sequence
MAKFNKDSVGGTILVVLLLSLVCSIIVAGSAVMLKPAQEEQKLLDKQKNILNVAGLLQEN TNVKETYAKFIEPRFVDLATGEYTQQADDSQQAIPADADKARIRSRSKTTEVYLVKDEQG QTQQVILPIYGTGLWSVMYGLVSVQPDGNTINGITYYQHGETPGLGGEIENPNWASLFKG KKLFDEQHQPAIRIVKGQAPQDEHSIDGLSGATLTGNGVQGTFNYWFSKDGFGPYLEKLH SGAN
Uniprot No.

Target Background

Function

The Na(+)-translocating NADH-quinone reductase (NQR) complex catalyzes the two-step reduction of ubiquinone-1 to ubiquinol, coupled with Na(+) ion transport from the cytoplasm to the periplasm. Subunits NqrA through NqrE are likely involved in the second step, converting ubisemiquinone to ubiquinol.

Database Links

KEGG: hin:HI0167

STRING: 71421.HI0167

Protein Families
NqrC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Na(+)-translocating NADH-quinone reductase (NQR) and what role does subunit C play in the complex?

Na(+)-translocating NADH-quinone reductase (NQR) is a respiratory enzyme complex found in many bacteria, including Haemophilus influenzae. It functions as a primary sodium pump that couples the oxidation of NADH to quinone with the translocation of sodium ions across the bacterial membrane. The NQR complex in H. influenzae serves as a redox-driven Na+ pump and utilizes Na+ circulation for energy coupling .

Subunit C (NqrC) is one of six subunits (NqrA-F) that make up the complete NQR complex. It contains a covalently bound FMN cofactor and plays a crucial role in the electron transfer pathway. NqrC accepts electrons from NqrB and transfers them to NqrD, functioning as an intermediate carrier in the electron transport chain within the complex.

How does the NQR complex from H. influenzae compare to similar complexes in other bacteria?

The NQR complex from H. influenzae shares significant structural and functional similarities with those found in marine bacteria like Vibrio alginolyticus. Research indicates that the respiratory chain of H. influenzae contains a Na+-dependent NQR that is essentially identical to those found in the marine V. alginolyticus, despite their different ecological niches (blood-loving vs. salt-loving bacteria) .

This conservation is particularly interesting as it suggests that H. influenzae, despite evolving to live in blood-rich environments, maintains a sodium-based energy transduction system similar to marine bacteria. The presence of this Na+-dependent system in both organisms indicates its fundamental importance in bacterial bioenergetics across diverse bacterial species and environments.

What expression systems are most effective for producing recombinant H. influenzae NqrC?

E. coli is the most widely used and effective expression system for producing recombinant H. influenzae NqrC, as demonstrated in commercial preparations . The protein can be expressed with various tags, with His-tagging at the N-terminus being a common approach to facilitate purification.

For optimal expression:

  • Use codon-optimized synthetic genes to overcome potential codon bias issues

  • Select expression vectors with strong inducible promoters (like T7)

  • Modulate temperature during induction (typically lowering to 25-30°C) to improve the yield of properly folded protein

  • Consider specialized E. coli strains designed for membrane protein expression (such as C41(DE3) or C43(DE3)) to increase success rates with NqrC's membrane-associated domains

What are the optimized conditions for purifying recombinant NqrC while maintaining its structural integrity?

Purification of recombinant NqrC typically involves a multi-step process:

  • Immobilized metal affinity chromatography (IMAC) for His-tagged proteins

  • Size exclusion chromatography to achieve high purity

  • Optional ion exchange chromatography for structural studies requiring higher purity

Buffer considerations are critical:

  • Use Tris/PBS-based buffers at pH 8.0

  • Include stabilizing agents such as 6% trehalose

  • Consider adding glycerol (5-10%) to stabilize the protein

  • Add protease inhibitors during initial extraction to prevent degradation

Storage recommendations:

  • Store at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles

  • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add 5-50% glycerol for long-term storage

How can researchers verify the correct folding and functionality of recombinant NqrC after purification?

Verification of correct folding and functionality requires multiple complementary approaches:

Structural Verification:

  • SDS-PAGE under reducing and non-reducing conditions to confirm the presence of disulfide bridges

  • Circular dichroism (CD) spectroscopy to assess secondary structure content

  • Limited proteolysis followed by mass spectrometry to identify properly folded domains

  • Thermal shift assays to evaluate protein stability and proper folding

Functional Verification:

  • Enzymatic activity assays measuring electron transfer capability

  • NADH oxidation rate measurements

  • Binding assays with known interaction partners (other NQR subunits)

  • Cofactor (FMN) incorporation analysis via spectroscopic methods

  • Reconstitution with other subunits to assess complex formation

What experimental methods are most reliable for measuring the Na+ translocation activity of reconstituted NQR complexes containing recombinant NqrC?

Several complementary methods provide reliable measurements of Na+ translocation:

Liposome Reconstitution Assays:

  • Incorporate purified NQR complex containing recombinant NqrC into proteoliposomes

  • Measure Na+ transport using fluorescent sodium indicators (e.g., SBFI) or radioactive 22Na+

  • Monitor changes in fluorescence or radioactivity over time in response to NADH addition

Solid-Supported Membrane (SSM) Electrophysiology:

  • Directly measure charge translocation associated with Na+ movement

  • Activate the NQR complex by rapid addition of NADH

  • Record electrical currents generated by Na+ movement across the membrane

Inverted Membrane Vesicle Preparations:

  • Prepare vesicles from cells expressing the complex

  • Measure Na+ uptake upon NADH addition

  • Use Na+-sensitive probes to monitor internal Na+ concentration changes

Control experiments using specific NQR inhibitors like HQNO (2-heptyl-4-hydroxyquinoline N-oxide) can confirm that observed Na+ movement is specifically due to NQR activity rather than other transporters or channels.

How can researchers distinguish between the electron transfer and Na+ translocation functions when studying NqrC and the NQR complex?

Distinguishing these coupled but distinct functions requires targeted experimental approaches:

For Electron Transfer Function:

  • Measure spectrophotometrically by monitoring reduction of artificial electron acceptors (DCPIP, ferricyanide)

  • Track NADH oxidation at 340 nm

  • Perform these measurements in detergent-solubilized preparations where Na+ translocation cannot occur

For Na+ Translocation Function:

  • Use Na+-specific ionophores (like monensin) to dissipate Na+ gradients without affecting electron transfer

  • Compare activity in the presence and absence of Na+ (replaced with K+ or Li+)

  • Employ site-directed mutagenesis of residues involved specifically in Na+ binding

For Coupling Between Functions:

  • Simultaneously measure NADH oxidation and Na+ movement to establish the coupling ratio

  • Compare these metrics in native complexes versus those with altered NqrC

  • Use inhibitors that specifically affect one function but not the other

What are the kinetic parameters of electron transfer through the NQR complex, and how does NqrC specifically contribute to these processes?

The kinetic parameters of electron transfer through the NQR complex typically show:

  • Km for NADH in the low micromolar range (10-50 μM)

  • Turnover numbers (kcat) of approximately 100-300 s-1 (values vary with experimental conditions)

NqrC's specific contributions include:

  • Serving as an intermediate electron carrier with its covalently bound FMN cofactor

  • The FMN cofactor has a midpoint potential of approximately -150 mV

  • Electron transfer through NqrC occurs in the millisecond time scale

  • The rate-limiting step is typically not within NqrC but at interfaces with other subunits

How is recombinant NqrC utilized in studies of bacterial energy metabolism and membrane transport systems?

Recombinant NqrC serves multiple research applications:

Reconstruction of Functional Complexes:

  • Enables in vitro studies of electron transfer pathways

  • Allows detailed characterization of Na+ pumping mechanisms

  • Facilitates study of subunit assembly and interactions

Tracking Catalytic Mechanisms:

  • Labeled NqrC (fluorescently or isotopically) tracks conformational changes

  • Helps identify critical residues involved in electron transfer

Comparative Studies:

  • Comparison between NqrC from different bacterial species (marine vs. pathogenic)

  • Provides insights into adaptive evolution of bioenergetic systems

Model System Applications:

  • Serves as a model for understanding complex membrane protein assembly

  • Helps elucidate principles of ion-coupled energy transduction

Antimicrobial Research:

  • Used in inhibitor screening assays targeting bacterial energy metabolism

  • Supports development of new strategies against H. influenzae infections

What insights have structural studies of NqrC provided about the electron transport chain in H. influenzae?

Structural studies have revealed critical insights about NqrC and electron transport:

  • The protein adopts a fold with both membrane-embedded and peripheral domains

  • The positioning of the FMN cofactor is optimized for electron transfer

  • Specific interfaces with NqrB and NqrD create a defined pathway for electrons

  • Conserved motifs are responsible for Na+ coordination

  • Conformational changes in NqrC couple electron transfer to ion translocation

The structures explain the directionality of electron flow and how H. influenzae generates a sodium motive force rather than the more common proton motive force for energy conservation. Comparisons with related complexes from other bacteria highlight unique features of H. influenzae NQR that may reflect adaptation to its host environment .

How does research on NqrC contribute to our understanding of H. influenzae pathogenesis and survival in host environments?

Research on NqrC provides important insights into H. influenzae pathogenesis:

  • H. influenzae, like marine bacteria, utilizes Na+ circulation for energy coupling despite evolving in blood-rich environments

  • This adaptation likely provides advantages during infection

  • The NQR complex allows H. influenzae to maintain energy production under the low oxygen conditions found in host niches

  • The Na+ dependence may explain H. influenzae's ability to persist in environments with fluctuating pH

These findings suggest that the respiratory chain adaptation in H. influenzae, specifically the Na+-dependent NQR system, plays a crucial role in the bacterium's ability to colonize and survive in diverse host environments, including the respiratory tract and middle ear during infection .

What are the most common challenges in expressing and purifying active recombinant NqrC, and how can researchers overcome them?

Challenge 1: Membrane Association and Poor Solubility

  • Solution: Use specialized membrane protein expression strains (C41/C43)

  • Add mild detergents like DDM or LDAO during purification

  • Consider fusion partners that enhance solubility

Challenge 2: Improper Folding

  • Solution: Express at lower temperatures (16-25°C)

  • Add oxidizing agents to encourage proper disulfide formation

  • Consider co-expression with chaperones

Challenge 3: Incomplete FMN Cofactor Incorporation

  • Solution: Supplement growth media with riboflavin

  • Extend expression time to improve cofactor incorporation

  • Separate holo- and apo-protein forms during purification

Challenge 4: Proteolytic Degradation

  • Solution: Include protease inhibitor cocktails

  • Perform all purification steps at 4°C

  • Minimize time between purification steps

Challenge 5: Low Yields

  • Solution: Use fusion tags like MBP or SUMO to improve expression

  • Optimize codon usage for E. coli expression

  • Scale up culture volumes or use high-density fermentation

Challenge 6: Activity Loss During Storage

  • Solution: Add stabilizing agents like glycerol (5-50%) or trehalose (6%)

  • Store at -80°C in small aliquots

  • Avoid freeze-thaw cycles

How can researchers troubleshoot inconsistent results in functional assays involving recombinant NqrC?

Variable Cofactor Incorporation:

  • Quantify FMN content spectroscopically (λmax ~450 nm)

  • Normalize activity data to the holo-enzyme concentration

Oxidation of Critical Thiols:

  • Include appropriate reducing agents in assay buffers

  • Prepare fresh protein samples before critical experiments

Subunit Stoichiometry Issues:

  • Optimize subunit ratios through titration experiments

  • Ensure complete complex formation before activity measurements

Buffer Composition Effects:

  • Systematically test pH, salt concentration (particularly Na+), and buffer systems

  • Standardize buffer components between experiments

Temperature Sensitivity:

  • Maintain strict temperature control during assays

  • Pre-equilibrate all components to the assay temperature

Membrane/Lipid Composition:

  • Standardize lipid composition for proteoliposome assays

  • Consider testing multiple lipid compositions

Protein Stability Issues:

  • Use freshly prepared enzyme when possible

  • Implement quality control through analytical SEC

What precautions should be taken when designing experiments to study interactions between NqrC and other NQR subunits?

Tagging Strategies:

  • Place tags at termini less likely to be involved in subunit interactions

  • Consider tag removal for interaction studies

  • Use orthogonal tagging for co-purification studies

Reconstitution Approach:

  • Test different orders of subunit addition during complex assembly

  • Optimize protein:lipid ratios for membrane reconstitution

  • Allow sufficient time for complex formation

Membrane Environment:

  • Use native membrane-mimicking environments (nanodiscs, proteoliposomes)

  • Select appropriate detergents that maintain native interactions

  • Consider the impact of lipid composition on complex stability

Control Experiments:

  • Include known non-interacting proteins as negative controls

  • Use well-characterized subunit mutants as references

  • Validate interactions using multiple complementary techniques

Site-Directed Mutagenesis:

Multiple Methodologies:

  • Employ complementary techniques (crosslinking, FRET, SPR, native MS)

  • Verify key findings with at least two independent methods

  • Consider time-resolved experiments for transient interactions

How does the Na+ dependency of the H. influenzae NQR complex compare with the proton-translocating respiratory complexes found in other bacteria?

The Na+ dependency of H. influenzae's NQR complex represents a significant bioenergetic divergence from the more common H+-translocating respiratory complexes:

Structural Differences:

  • Na+-NQR uses 6 subunits versus 14+ in proton-pumping NDH-1 (Complex I)

  • The architectural organization is entirely different

  • Na+-NQR employs covalently bound FMN cofactors rather than iron-sulfur clusters

Functional Similarities:

  • Both systems operate with similar thermodynamic efficiency

  • Both couple electron transfer to ion translocation

  • Both generate electrochemical gradients for ATP synthesis

Evolutionary Implications:

  • Na+-NQR evolved independently from NDH-1

  • H. influenzae shares this system with marine bacteria despite different evolutionary pressures

  • The presence in blood-loving H. influenzae suggests functional advantages beyond marine adaptation

This remarkable similarity between the NQR complex in the salt-loving marine bacteria and the blood-loving H. influenzae indicates that Na+ circulation for energy coupling is a versatile strategy that can be advantageous in diverse environments .

What genomic and proteomic approaches can be used to study the regulation of NqrC expression in different H. influenzae strains?

Genomic Approaches:

  • Comparative genomics of nqr operon regulatory regions across strains

  • ChIP-seq targeting transcriptional regulators controlling nqrC

  • RNA-seq under various conditions (oxygen limitation, Na+ concentration changes)

  • Ribosome profiling to quantify translation efficiency

  • CRISPR interference screens to identify regulatory factors

Proteomic Approaches:

  • Targeted mass spectrometry for absolute quantification of NqrC

  • Phosphoproteomics to identify regulatory modifications

  • Protein-protein interaction studies to identify regulatory partners

  • Pulse-chase proteomics to determine protein turnover rates

  • Post-translational modification analysis

Integrated Approaches:

  • Multi-omics integration through computational modeling

  • Correlation of NqrC expression with virulence factor expression

  • Single-cell approaches to characterize expression heterogeneity

  • Dual RNA-seq during host-pathogen interaction

These approaches can reveal how NqrC expression varies between clinical isolates from different infection sites and how environmental conditions impact expression patterns, potentially identifying regulatory mechanisms specific to H. influenzae adaptation.

How might structure-based drug design be applied to develop inhibitors specifically targeting H. influenzae NqrC?

Structure-based drug design targeting NqrC could follow this systematic approach:

Target Identification and Validation:

  • Determine high-resolution structures of NqrC using X-ray crystallography or cryo-EM

  • Identify unique structural features distinct from human proteins

  • Validate essentiality through genetic approaches

Computational Analysis:

  • Perform molecular dynamics simulations to identify conformational states

  • Identify potential binding pockets at functional sites

  • Target interfaces with other NQR subunits or near the FMN cofactor

Hit Identification:

  • Virtual screening of compound libraries

  • Fragment-based approaches to identify initial binders

  • Design compounds that interfere with electron transfer

Lead Optimization:

  • Structure-guided modifications to improve binding affinity

  • Enhance selectivity by targeting H. influenzae-specific features

  • Optimize for cell penetration and pharmacokinetic properties

Functional Validation:

  • Enzyme inhibition assays to determine IC50/Ki values

  • Whole-cell assays to assess antimicrobial efficacy

  • Resistance development studies to identify escape mutations

This approach leverages the unique properties of NqrC to develop targeted antimicrobials against H. influenzae, potentially addressing an important respiratory pathogen with a novel mechanism of action.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.