Recombinant Haemophilus influenzae Na (+)-translocating NADH-quinone reductase subunit E

What is the biological significance of Na(+)-translocating NADH-quinone reductase in Haemophilus influenzae?

Unlike mitochondrial Complex I, Na+-NQR features a unique set of cofactors including FAD, covalently bound FMNs, riboflavin, and iron-sulfur centers that facilitate electron transfer through the complex. The sodium-pumping mechanism represents an adaptation that is widespread among bacterial pathogens, making it a promising target for antimicrobial development, particularly for multidrug-resistant strains of clinical importance .

What is the structural organization of the Na+-NQR complex in Haemophilus influenzae?

The Na+-NQR complex in Haemophilus influenzae has a sophisticated structural organization comprising six subunits designated NqrA, NqrB, NqrC, NqrD, NqrE, and NqrF. These subunits collectively harbor a unique array of cofactors including one flavin adenine dinucleotide (FAD), two covalently bound flavin mononucleotides (FMNs), one riboflavin, and two iron-sulfur centers. The arrangement of these subunits creates a transmembrane complex that enables electron transfer from NADH to ubiquinone while facilitating the translocation of two Na+ ions across the cytoplasmic membrane .

X-ray crystallography studies at 3.5 Å resolution have revealed the spatial arrangement and topology of these six subunits. The complex features electron transfer pathways that remarkably traverse the membrane twice during the catalytic cycle. This structural arrangement allows electrons to be shuttled from NADH across the membrane to quinone through a series of redox cofactors positioned precisely to facilitate efficient electron transfer. The electron transfer pathway is intimately coupled to conformational changes that drive ion translocation .

What specific role does the NqrE subunit play in the Na+-NQR complex?

The primary sequence of NqrE (MEHYISLFVKAVFIENMALSFFLGMCTFLAVSKKVSTAFGLGIAVTFVLGIAVPVNQLIYANVLKENALIEGVDLSFLNFITFIGVIAGLVQILEMVLDKFMPSLYNALGIFLPLIAVNCAIFGGVSFMVQRDYNFPESIVYGFGSGLGWMLAIVALAGLTEKMKYADIPAGLKGLGITFISVGLMALGFMSFSGIQL) reveals a predominance of hydrophobic residues, particularly in the transmembrane domains .

Within the functional architecture of the Na+-NQR complex, NqrE contributes to forming the ion translocation pathway by participating in the conformational changes that occur during the catalytic cycle. While not directly involved in binding the redox cofactors, NqrE works in concert with other subunits, particularly NqrB, which contains the sodium binding site. The spatial arrangement of NqrE relative to other subunits facilitates the mechanical coupling between electron transfer and ion translocation events .

What expression systems are most effective for producing recombinant NqrE protein?

Producing functional recombinant NqrE protein presents significant challenges due to its highly hydrophobic nature and membrane localization. The most effective expression systems employ specialized approaches for membrane protein production:

• E. coli-based expression systems modified for membrane protein production represent the most common approach. These systems typically utilize:

  • C41(DE3) or C43(DE3) bacterial strains specifically designed for membrane protein expression

  • Vectors containing mild promoters to prevent toxic accumulation

  • Fusion partners such as maltose-binding protein (MBP) or thioredoxin to enhance solubility

  • Controlled induction conditions with IPTG at reduced temperatures (16-20°C)

• Cell-free expression systems have emerged as valuable alternatives, allowing direct incorporation of NqrE into liposomes or nanodiscs during synthesis, which preserves native-like membrane environments.

For proper folding and stability, expression protocols must include appropriate detergents (typically n-dodecyl-β-D-maltoside or digitonin) for membrane protein extraction and purification. The choice of tag system significantly impacts purification efficiency, with His-tags positioned at the N-terminus generally providing better results than C-terminal tags for NqrE.

The recombinant protein is typically stored in Tris-based buffer with 50% glycerol to maintain stability during storage, and aliquots should be maintained at -20°C or -80°C for extended storage to preserve activity .

What methodologies are most effective for studying electron transfer mechanisms in the Na+-NQR complex?

Investigating electron transfer mechanisms in the Na+-NQR complex requires integrated approaches that combine structural, spectroscopic, and biochemical techniques:

• Time-resolved spectroscopic techniques provide critical insights into electron transfer kinetics:

  • Stopped-flow spectrophotometry can track flavin redox state changes during catalysis

  • Electron paramagnetic resonance (EPR) spectroscopy enables detection of transient radical intermediates and iron-sulfur cluster redox states

  • Ultrafast transient absorption spectroscopy can resolve electron transfer events occurring on nanosecond to microsecond timescales

• Site-directed mutagenesis coupled with functional assays allows researchers to:

  • Systematically modify residues along the proposed electron transfer pathway

  • Quantify effects on electron transfer rates using NADH oxidation and quinone reduction assays

  • Correlate structural features with functional outcomes

• Cryo-EM conformational analysis has proven particularly valuable by:

  • Capturing distinct conformational states representing different stages of the catalytic cycle

  • Revealing the movement of the NqrC subunit which functions as an electron transfer switch

  • Demonstrating how the redox state of the unique intramembranous [2Fe-2S] cluster orchestrates conformational changes that drive ion translocation

A combined methodological workflow typically begins with structural characterization, followed by targeted mutagenesis of key residues, spectroscopic analysis of electron transfer events, and correlation with ion translocation measurements. This integrated approach has revealed that electron transfer in Na+-NQR follows a unique pathway where electrons from NADH traverse the membrane twice before reducing the quinone substrate, a mechanism distinctly different from mitochondrial Complex I .

How does the Na+ translocation mechanism in Haemophilus influenzae Na+-NQR differ from other ion-pumping respiratory complexes?

The Na+ translocation mechanism in Haemophilus influenzae Na+-NQR represents a distinct bioenergetic strategy that differs fundamentally from other respiratory complexes:

Recent cryo-EM and X-ray structures reveal that Na+-NQR employs a unique switching mechanism where the NqrC subunit undergoes large conformational changes coupled to electron transfer. The redox state of an intramembranous [2Fe-2S] cluster orchestrates these movements, functioning as an electron transfer switch that controls Na+ release from a binding site located in subunit NqrB .

Unlike Complex I, which utilizes a series of conformational changes propagated through antiporter-like subunits, Na+-NQR has a more direct coupling mechanism. The electron transfer pathway crosses the membrane twice, with each crossing associated with the translocation of one Na+ ion. This mechanism represents a novel evolutionary solution to the challenge of coupling electron transfer to ion translocation in respiratory chain complexes .

What approaches are most effective for investigating the structure-function relationship of NqrE within the Na+-NQR complex?

Elucidating the structure-function relationship of NqrE requires complementary methodologies that bridge structural information with functional insights:

• Integrative structural biology approaches:

  • High-resolution cryo-EM analysis can capture different conformational states of NqrE within the intact Na+-NQR complex

  • Cross-linking coupled with mass spectrometry identifies interaction interfaces between NqrE and other subunits

  • Molecular dynamics simulations predict conformational changes and potential ion pathways through NqrE

• Systematic mutagenesis strategies:

  • Alanine-scanning mutagenesis of conserved residues in transmembrane regions can identify essential functional elements

  • Introduction of reporter groups (e.g., cysteine residues for fluorescence labeling) enables tracking of conformational dynamics

  • Chimeric constructs swapping domains between NqrE orthologs from different species can identify species-specific functional regions

• Functional reconstitution experiments:

  • Reconstitution of purified NqrE with other Na+-NQR subunits in proteoliposomes allows direct measurement of ion translocation

  • Solid-supported membrane electrophysiology can detect charge movements associated with Na+ translocation

  • Isothermal titration calorimetry quantifies thermodynamic parameters of Na+ binding

What are the implications of Na+-NQR inhibition for developing novel antimicrobials against Haemophilus influenzae?

The Na+-NQR complex represents a promising antimicrobial target due to its essential role in energy metabolism and its absence in human cells. Several factors make Na+-NQR inhibition particularly attractive for antimicrobial development against Haemophilus influenzae:

• Target specificity and reduced toxicity potential:

  • Na+-NQR is absent in mammalian cells, which rely on H+-translocating Complex I

  • The unique cofactor composition and structure of Na+-NQR allow for highly selective inhibitor design

  • Na+-NQR is widespread among bacterial pathogens including multidrug-resistant Pseudomonas and Klebsiella strains

• Metabolic vulnerability:

  • Inhibition of Na+-NQR disrupts bacterial bioenergetics, affecting multiple cellular processes

  • Na+ gradient disruption impacts secondary active transport systems dependent on the sodium motive force

  • Energy limitation caused by Na+-NQR inhibition can potentially reduce virulence factor expression

• Resistance development considerations:

  • The complex structure of Na+-NQR with multiple subunits presents a high genetic barrier to resistance

  • Essential nature of the complex makes compensatory mutations potentially costly to bacterial fitness

  • Targeting conserved regions across bacterial species can reduce resistance development

Current inhibitor development strategies focus on compounds that interfere with electron transfer through the complex or specifically disrupt the conformational changes necessary for Na+ translocation. Quinone-site inhibitors and compounds targeting the NADH-binding domain of NqrF have shown promising activity. Additionally, compounds disrupting subunit interactions, particularly those involving NqrE, represent an untapped approach for developing novel inhibitors with potentially lower resistance development .

How can recombinant NqrE be used to study the assembly process of the Na+-NQR complex?

Recombinant NqrE provides a valuable tool for investigating the assembly pathway of the Na+-NQR complex in Haemophilus influenzae. Understanding complex assembly has implications for both fundamental biology and antimicrobial development strategies:

• In vitro reconstitution experiments:

  • Purified recombinant NqrE can be combined with other Na+-NQR subunits in controlled sequential addition experiments

  • Biochemical assays measuring complex formation efficiency (size-exclusion chromatography, blue native PAGE) reveal the order of assembly

  • Activity measurements after each addition step identify critical interactions required for functional complex formation

• Protein-protein interaction mapping:

  • Techniques like microscale thermophoresis and surface plasmon resonance quantify binding affinities between NqrE and other subunits

  • Hydrogen-deuterium exchange mass spectrometry identifies interaction interfaces and conformational changes during assembly

  • Chemical cross-linking coupled with mass spectrometry creates spatial constraints that inform assembly models

• Cellular assembly pathway investigation:

  • Pulse-chase experiments with epitope-tagged NqrE track its incorporation into the complex over time

  • Co-immunoprecipitation with antibodies against NqrE at different time points identifies assembly intermediates

  • Super-resolution microscopy with fluorescently labeled NqrE can visualize the spatial organization of assembly in living bacteria

These approaches have revealed that the assembly of Na+-NQR complex likely proceeds through specific intermediates, with the membrane subunits (including NqrE) potentially forming a scaffold for subsequent addition of peripheral components. The correct insertion of cofactors, particularly the [2Fe-2S] clusters and flavins, appears to be coordinated with specific assembly steps. Disrupting key assembly interactions through targeted compounds or peptides represents a novel strategy for antimicrobial development .

What are the optimal conditions for functional characterization of recombinant NqrE protein?

Functional characterization of recombinant NqrE presents unique challenges due to its membrane-integral nature. Optimized experimental conditions must be carefully established:

• Detergent selection and concentration:

  • Mild detergents such as n-dodecyl-β-D-maltoside (DDM) at concentrations just above CMC (0.01-0.02%)

  • Digitonin (0.1-0.5%) for applications requiring preservation of protein-protein interactions

  • Detergent screening arrays are recommended to identify optimal conditions for specific assays

• Buffer composition:

  • Tris-based buffers (20-50 mM, pH 7.5-8.0) with physiological ionic strength (100-150 mM NaCl)

  • Inclusion of glycerol (10-20%) enhances stability during functional assays

  • Addition of specific phospholipids (0.01-0.05 mg/ml) often improves functional properties

• Reconstitution strategies:

  • Proteoliposome preparation using E. coli polar lipid extract with cholesterol (80:20 ratio)

  • Controlled detergent removal via dialysis or bio-beads for optimal protein insertion

  • Size control through extrusion through 100-200 nm filters improves reproducibility

• Functional assay considerations:

  • Na+ translocation measurements using pH-sensitive or Na+-sensitive fluorescent probes

  • Membrane potential measurements with potential-sensitive dyes like DiSC3(5)

  • Co-reconstitution with other Na+-NQR subunits for activity coupling experiments

Temperature control is particularly critical, with most functional assays showing optimal results at 30-32°C. Activity measurements should include appropriate controls for passive leak pathways and non-specific effects of the reconstitution process. When studying NqrE in the context of the full complex, NADH oxidation and quinone reduction activities provide indirect but quantitative measures of functional integrity .

What analytical techniques best resolve conformational changes in NqrE during the catalytic cycle?

Resolving the conformational dynamics of NqrE during catalysis requires sophisticated biophysical techniques that can detect structural changes in membrane proteins:

• Single-molecule approaches:

  • Förster resonance energy transfer (FRET) with strategically placed fluorophores on cysteine residues

  • High-speed atomic force microscopy (HS-AFM) for direct visualization of conformational changes

  • Single-molecule particle tracking in supported lipid bilayers

• Spectroscopic methods:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) identifies regions with altered solvent accessibility

  • Site-directed spin labeling coupled with electron paramagnetic resonance (SDSL-EPR)

  • Infrared spectroscopy focusing on amide bands sensitive to secondary structure changes

• Structural biology techniques:

  • Time-resolved cryo-EM with reaction triggering captures intermediates in the catalytic cycle

  • Disulfide cross-linking traps specific conformational states for structural analysis

  • Molecular dynamics simulations predict conformational transitions based on experimental structures

Recent studies using these techniques have demonstrated that Na+-NQR undergoes large conformational changes during catalysis, with the NqrC subunit acting as an electron transfer switch. The redox state of a unique intramembranous [2Fe-2S] cluster orchestrates these movements. While NqrE itself does not contain redox cofactors, it undergoes coordinated conformational changes that contribute to the ion translocation pathway through interactions with NqrB, which contains the Na+ binding site .

A particularly effective experimental design combines site-directed fluorescent labeling of NqrE with reconstitution into liposomes containing voltage-sensitive dyes. This approach allows simultaneous monitoring of conformational changes (via FRET) and ion translocation events (via membrane potential changes), providing direct evidence for the coupling mechanism.

How might advances in synthetic biology enhance our understanding of Na+-NQR function?

Synthetic biology approaches offer powerful new avenues for investigating the structure-function relationships in the Na+-NQR complex:

• Designer Na+-NQR variants:

  • Modular redesign of subunit interfaces to enhance stability for structural studies

  • Domain swapping between different bacterial Na+-NQR complexes to identify species-specific features

  • Incorporation of non-canonical amino acids at key positions for site-specific crosslinking or spectroscopic probes

• Minimal functional systems:

  • Systematic subunit reduction experiments to determine the minimal components required for specific functions

  • Construction of simplified chimeric complexes combining features from different ion-translocating enzymes

  • In vitro reconstitution of artificial electron transfer pathways with defined components

• Biosensor development:

  • Engineering Na+-NQR variants with integrated fluorescent reporters responsive to conformational changes

  • Creation of whole-cell biosensors for screening Na+-NQR inhibitors based on energy metabolism readouts

  • Development of synthetic circuits coupling Na+-NQR activity to easily detectable reporter outputs

These synthetic biology approaches would complement traditional structural and biochemical methods by allowing precise control over complex composition and properties. For instance, systematically altering the NqrE subunit through synthetic variants could definitively resolve its contribution to the ion translocation pathway and identify residues critical for conformational coupling.

What computational approaches can advance our understanding of ion translocation mechanisms in Na+-NQR?

Computational methods offer increasingly powerful tools for investigating the complex mechanisms of Na+-NQR function:

• Advanced molecular dynamics simulations:

  • Multi-scale simulations combining quantum mechanics with molecular mechanics (QM/MM) can model electron transfer coupled to conformational changes

  • Enhanced sampling techniques (metadynamics, umbrella sampling) can explore energy landscapes of Na+ translocation

  • Coarse-grained models enable longer timescale simulations of complete catalytic cycles

• Machine learning applications:

  • Neural network models trained on experimental data can predict functional impacts of mutations

  • Graph convolutional networks applied to protein structures identify allosteric pathways connecting electron transfer sites to ion translocation regions

  • Generative models suggest novel inhibitor candidates targeting specific conformational states

• Integrative computational approaches:

  • Molecular docking combined with molecular dynamics refines understanding of inhibitor binding mechanisms

  • Normal mode analysis identifies collective motions potentially involved in ion translocation

  • Network analysis of residue interactions maps communication pathways between functional sites

How does the evolutionary history of Na+-NQR inform functional studies and inhibitor development?

Evolutionary analysis of the Na+-NQR complex provides valuable context for functional studies and targeted inhibitor development:

• Phylogenetic distribution patterns:

  • Na+-NQR is present in diverse bacterial lineages but with notable phylogenetic clustering

  • The complex appears prevalent among marine and pathogenic bacteria, suggesting adaptation to specific environmental niches

  • Comparative genomics reveals conservation patterns identifying functionally critical regions across diverse species

• Evolutionary implications for mechanism:

  • Sequence conservation analysis identifies residues under strong selective pressure, highlighting functionally essential positions

  • Coevolution analysis detects correlated mutations between subunits, revealing interaction networks and allosteric pathways

  • Ancestral sequence reconstruction creates models of evolutionary intermediates, offering insights into functional adaptation

• Applications to inhibitor development:

  • Conservation analysis guides targeting of invariant regions to create broad-spectrum inhibitors

  • Identification of pathogen-specific features enables selective targeting of Na+-NQR in disease-causing bacteria

  • Understanding evolutionary constraints informs resistance development potential against different inhibitor classes

Evolutionary analysis has revealed that while Na+-NQR is widespread among pathogens like Vibrio cholerae, Haemophilus influenzae, Pseudomonas, and Klebsiella strains, significant sequence divergence exists in certain regions. This pattern suggests that while core functions are conserved, species-specific adaptations have occurred. Targeting the highly conserved regions involved in electron transfer and Na+ binding would likely produce broad-spectrum inhibitors, while exploiting species-specific features of NqrE and other subunits could lead to selective antimicrobial agents with reduced impact on beneficial bacteria .