Recombinant Haemophilus influenzae Na (+)-translocating NADH-quinone reductase subunit E (nqrE)

Shipped with Ice Packs
In Stock

Description

Recombinant nqrE Production Systems

Recombinant nqrE is synthesized using heterologous expression platforms to study its biochemical properties or develop targeted therapies.

Production SystemHostTagApplicationsSource
E. coliStrain PittEENoneStructural studies, enzyme kineticsCreative Biolabs
E. coliNot specifiedN-terminal HisVaccine antigen developmentCreative Biomart

Key features:

  • High purity (>95%) achieved via affinity chromatography .

  • Retains native conformation and enzymatic activity in vitro .

Research Applications and Findings

Vaccine Development:

  • Recombinant nqrE is a candidate antigen for vaccines against H. influenzae, particularly non-typeable strains (NTHi) responsible for otitis media and pneumonia .

  • Preclinical studies demonstrate its ability to induce bactericidal antibodies in animal models, a surrogate marker for protective immunity .

Antibiotic Targeting:

  • Na⁺-NQR is absent in humans, making nqrE a promising target for narrow-spectrum antibiotics .

  • Inhibitors like korormicin A and aurachin D-42 bind to nqrE homologs in Vibrio cholerae, disrupting sodium pumping . Structural insights from these studies inform drug design for H. influenzae .

Metabolic Role in H. influenzae

  • Under anaerobic conditions, H. influenzae relies on Na⁺-NQR for redox balancing via "respiration-assisted fermentation" .

  • Deletion of nqrE impairs growth in low-oxygen environments, such as the middle ear or lungs, reducing bacterial virulence .

Challenges and Future Directions

  • Structural Flexibility: The N-terminal region of nqrE is disordered without inhibitor binding, complicating crystallization . Cryo-EM studies with inhibitors like korormicin A have resolved this issue, enabling detailed mechanistic insights .

  • Antimicrobial Resistance: Rising multidrug-resistant H. influenzae strains necessitate novel therapies targeting Na⁺-NQR .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this during order placement.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nqrE; NTHI0258; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Haemophilus influenzae (strain 86-028NP)
Target Names
nqrE
Target Protein Sequence
MEHYISLFVKAVFIENMALSFFLGMCTFLAVSKKVSTAFGLGIAVTFVLGIAVPVNQLIY ANVLKENALIEGVDLSFLNFITFIGVIAGLVQILEMVLDKFMPSLYNALGIFLPLIAVNC AIFGGVSFMVQRDYNFPESIVYGFGSGLGWMLAIVALAGLTEKMKYADIPAGLKGLGITF ISVGLMALGFMSFSGIQL
Uniprot No.

Target Background

Function

The NQR complex catalyzes the two-step reduction of ubiquinone-1 to ubiquinol, coupled with the transport of Na+ ions from the cytoplasm to the periplasm. NqrA through NqrE are likely involved in the second step, converting ubisemiquinone to ubiquinol.

Database Links

KEGG: hit:NTHI0258

Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Na(+)-translocating NADH-quinone reductase (Na+-NQR) and how does it function in Haemophilus influenzae?

Na(+)-translocating NADH-quinone reductase (Na+-NQR) is a redox-driven sodium pump that operates in the respiratory chains of various bacteria, including Haemophilus influenzae. This complex catalyzes electron transfer from NADH to ubiquinone in the bacterial respiratory chain, coupled with Na+ translocation across the membrane. In H. influenzae specifically, the respiratory chain contains a Na+-dependent NQR that is functionally similar to those found in marine bacteria like Vibrio alginolyticus. This indicates that although H. influenzae is a blood-loving bacterium rather than a salt-loving marine organism, it utilizes Na+ circulation for energy coupling through a redox-driven Na+ pump .

What is the genomic context of nqrE in Haemophilus influenzae?

The nqrE gene is part of the nqr operon in H. influenzae, which encodes the subunits of the Na+-translocating NADH-quinone reductase complex. This operon is similar to that found in marine bacteria such as Vibrio alginolyticus. The genomic organization typically includes genes encoding other NQR subunits, as well as maturation factors necessary for the proper assembly and functioning of the complex. Notably, the nqr operon is often associated with the apbE gene, which encodes a flavin transferase involved in the covalent attachment of flavin mononucleotide (FMN) residues during Na+-NQR maturation. Additionally, another gene, previously annotated as duf539 and now renamed nqrM, is typically found following the apbE gene in bacteria containing Na+-NQR .

What recombinant expression systems are effective for producing functional nqrE protein?

For recombinant expression of H. influenzae nqrE protein, several expression systems have been employed successfully in research settings. Expression in E. coli is commonly used, though it's important to note that merely expressing the nqr operon alone in E. coli (which lacks its own Na+-NQR) results in an enzyme incapable of Na+-dependent NADH or dNADH oxidation. For fully functional expression, co-expression with associated maturation factors is essential. Specifically, the nqr operon must be co-expressed with both the apbE gene (encoding flavin transferase) and the nqrM gene for proper assembly and function of the Na+-NQR complex .

Alternative expression systems include yeast, baculovirus, and mammalian cell systems, each with potential advantages depending on the research objectives. When choosing an expression system, researchers should consider factors such as post-translational modifications, protein folding requirements, and the need for membrane integration, as nqrE is a membrane-associated protein .

What are the recommended experimental parameters for RNA-seq analysis of nqrE expression?

When designing RNA-seq experiments to analyze nqrE expression in H. influenzae, several key parameters should be considered:

  • Replication: Multiple biological replicates are essential for statistical robustness. A minimum of three replicates is recommended, though more may be necessary depending on the expected effect size and biological variability.

  • Sequencing approach: Both paired-end and single-end sequencing approaches can be used, with paired-end providing better resolution for splice variants and gene fusion events, though single-end may be sufficient for basic differential expression analysis.

  • Read length: Longer read lengths (≥75 bp) provide better specificity for mapping to the reference genome, especially in regions with sequence similarities.

  • Sequencing depth: For gene expression analysis, a minimum of 10-20 million reads per sample is recommended, though deeper sequencing may be necessary for detecting low-abundance transcripts.

These parameters should be adjusted based on the specific research questions being addressed. Additionally, appropriate quality control measures should be implemented at each stage of the workflow, from RNA extraction to final data analysis .

How can the functional activity of recombinant nqrE be assessed in vitro?

Assessment of recombinant nqrE functional activity requires consideration of its role within the larger Na+-NQR complex. Key methodological approaches include:

  • NADH/dNADH oxidation assays: Monitoring the Na+-dependent oxidation of NADH or dNADH (reduced nicotinamide hypoxanthine dinucleotide) spectrophotometrically at appropriate wavelengths.

  • Na+ translocation measurements: Utilizing radioactive Na+ or Na+-sensitive fluorescent probes to measure Na+ transport across membrane vesicles containing the reconstituted Na+-NQR complex.

  • Electron transfer assays: Assessing electron transfer from NADH to ubiquinone or artificial electron acceptors, which can be monitored spectrophotometrically.

  • Complex assembly analysis: Employing techniques such as Blue Native PAGE or size-exclusion chromatography to assess whether nqrE properly incorporates into the Na+-NQR complex.

It's important to note that isolated nqrE subunit may not exhibit functional activity on its own, as its function depends on proper assembly with other subunits of the Na+-NQR complex .

How do mutations in conserved cysteine residues affect nqrE function within the Na+-NQR complex?

The Na+-NQR complex contains critical cysteine residues that play essential roles in its function. By analogy with the related NqrM protein, which contains four conserved cysteine residues, mutations in these residues can have profound effects on the assembly and function of the complex. For example, in NqrM, mutation of Cys33 to Ser completely prevented Na+-NQR maturation, while mutations in other conserved Cys residues only decreased the yield of mature protein .

Similar effects might be expected for conserved cysteine residues in nqrE, particularly those involved in forming the (Cys)4[Fe] center between NqrD and NqrE subunits. This iron-sulfur cluster is critical for electron transfer within the complex. Research approaches to study these effects include:

  • Site-directed mutagenesis of individual cysteine residues

  • Expression of mutant proteins and assessment of complex assembly

  • Functional assays to determine the impact on NADH oxidation and Na+ translocation

  • Structural studies to visualize changes in protein conformation and complex integrity

The results of such studies can provide insights into the molecular mechanisms of electron transfer and ion translocation in the Na+-NQR complex .

What is the comparative analysis of nqrE structure and function between Haemophilus influenzae and other bacterial species?

Comparative analysis reveals that the Na+-NQR complex, including the nqrE subunit, is present in various bacterial species but with interesting evolutionary adaptations. H. influenzae, a blood-loving pathogen, possesses a Na+-dependent NQR that is essentially identical to those found in marine bacteria like Vibrio alginolyticus, despite their vastly different ecological niches .

Key points of comparison include:

FeatureH. influenzaeMarine bacteria (e.g., V. alginolyticus)Other bacterial species
Na+ dependencyPresentPresentVariable
Gene organizationnqr operon with associated apbE and nqrMSimilar organizationVariable
Ecological nicheBlood/respiratory tractHigh-salt environmentsDiverse
Evolutionary significanceAdaptation to host environmentAdaptation to marine environmentContext-dependent

This comparative analysis suggests that Na+-NQR may represent an ancient and versatile bioenergetic mechanism that has been retained through evolution and adapted to different environmental conditions. The presence of similar functional complexes in distantly related bacteria highlights the fundamental importance of this ion-pumping system in bacterial bioenergetics .

How does the maturation of nqrE within the Na+-NQR complex depend on accessory proteins?

The maturation of the Na+-NQR complex, including the nqrE subunit, depends critically on specific accessory proteins. Two key maturation factors have been identified:

  • ApbE (Flavin transferase): This enzyme catalyzes the covalent attachment of flavin mononucleotide (FMN) residues during Na+-NQR maturation. This post-translational modification is essential for the function of certain subunits within the complex.

  • NqrM (previously DUF539): This protein is required for the assembly of a functional Na+-NQR complex. Research has shown that expression of the nqr operon alone or with just the apbE gene in E. coli results in an enzyme incapable of Na+-dependent NADH oxidation. Only when co-expressed with the nqrM gene is fully functional Na+-NQR restored. The NqrM protein contains a single putative transmembrane α-helix and four conserved Cys residues, with Cys33 being particularly critical for function.

Experimental evidence indicates that the Na+-NQR complex isolated from nqrM-deficient strains lacks several subunits, confirming that NqrM is necessary for proper complex assembly. NqrM is believed to be involved in the delivery of iron to form the (Cys)4[Fe] center between subunits NqrD and NqrE .

What are the optimal experimental design approaches for studying nqrE function in bacterial mutants?

When designing experiments to study nqrE function in bacterial mutants, several approaches should be considered:

  • Genetic manipulation strategies:

    • Gene knockout or deletion: Complete removal of nqrE to assess its essentiality

    • Site-directed mutagenesis: Modification of specific residues to study structure-function relationships

    • Complementation studies: Reintroduction of wild-type or mutant nqrE to confirm phenotypes

  • Experimental designs:

    • Randomized complete block designs: To control for batch effects when processing multiple mutant strains

    • Factorial designs: To study interactions between nqrE mutations and environmental conditions

    • Latin square designs: When testing multiple variables with limited resources

  • Control considerations:

    • Include wild-type strains in all experiments

    • Consider the use of isogenic controls differing only in the gene of interest

    • Include positive controls (known mutants with established phenotypes) when possible

  • Phenotypic assays:

    • Growth curves under various conditions (different carbon sources, Na+ concentrations)

    • Membrane potential measurements

    • Respiratory chain activity assays

    • In vivo Na+ transport studies

Statistical power analysis should be conducted prior to experimentation to determine appropriate sample sizes, and data should be analyzed using appropriate statistical methods, such as ANOVA for factorial designs .

How can proteomics approaches be optimized for studying nqrE interactions within the Na+-NQR complex?

Proteomic approaches offer valuable insights into nqrE interactions within the Na+-NQR complex. Optimal strategies include:

  • Sample preparation:

    • Gentle membrane solubilization using detergents compatible with mass spectrometry (e.g., digitonin, DDM)

    • Crosslinking approaches to capture transient interactions

    • Affinity purification using tagged nqrE or other complex components

  • Analytical techniques:

    • Blue Native PAGE followed by second-dimension SDS-PAGE for complex composition analysis

    • Co-immunoprecipitation coupled with mass spectrometry

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

    • Chemical crosslinking followed by mass spectrometry (XL-MS) to identify spatial proximity

  • Data analysis:

    • Use appropriate search algorithms optimized for membrane proteins

    • Apply stringent filtering criteria to minimize false positives

    • Validate key interactions through orthogonal methods (e.g., FRET, BiFC)

  • Control considerations:

    • Include negative controls (non-specific antibodies, unrelated tagged proteins)

    • Consider the use of nqrE point mutants to map specific interaction domains

    • Analyze samples from strains lacking key maturation factors (apbE, nqrM) to understand assembly dependencies

These approaches can provide detailed information about the assembly pathway, subunit interactions, and structural organization of the Na+-NQR complex, contributing to a deeper understanding of nqrE's role within this important bacterial enzyme complex .

What analytical methods are most effective for characterizing the redox properties of recombinant nqrE?

Characterization of the redox properties of recombinant nqrE requires specialized analytical methods that can probe electron transfer processes within the protein. The most effective approaches include:

  • Spectroscopic methods:

    • UV-visible spectroscopy to monitor chromophore reduction/oxidation

    • Electron paramagnetic resonance (EPR) spectroscopy to detect and characterize paramagnetic centers

    • Resonance Raman spectroscopy to probe the vibrational properties of redox-active cofactors

    • Magnetic circular dichroism (MCD) for additional insights into electronic structures

  • Electrochemical techniques:

    • Protein film voltammetry to determine redox potentials

    • Spectroelectrochemistry to correlate spectral changes with redox states

    • Potentiometric titrations to establish redox potential values

  • Kinetic measurements:

    • Stopped-flow spectroscopy for fast reaction kinetics

    • Rapid freeze-quench EPR for capturing transient intermediates

    • Pre-steady state kinetics to dissect electron transfer steps

  • Structural correlations:

    • X-ray absorption spectroscopy (XAS) to probe metal center coordination

    • Protein crystallography of different redox states

    • Computational modeling of electron transfer pathways

For meaningful analysis, it's essential to maintain anaerobic conditions during sample preparation and analysis when working with air-sensitive redox centers. Additionally, temperature control is critical for studying the temperature dependence of electron transfer processes and for stabilizing reactive intermediates .

How does understanding nqrE function contribute to knowledge of Haemophilus influenzae pathogenesis?

Understanding nqrE function within the Na+-NQR complex provides significant insights into H. influenzae pathogenesis through several mechanisms:

  • Bioenergetic adaptations: The Na+-NQR complex represents a specialized adaptation for energy generation in H. influenzae. By utilizing a Na+ circulation system for energy coupling, similar to salt-loving marine bacteria, H. influenzae may gain bioenergetic advantages within its host environments. This adaptation could be particularly important during colonization of mucosal surfaces of the upper respiratory tract, where ionic conditions may fluctuate .

  • Respiratory flexibility: The presence of Na+-dependent respiratory mechanisms provides metabolic flexibility that may contribute to survival under varying host conditions. This flexibility could be particularly important during transitions between commensal colonization and pathogenic states.

  • Potential drug target: The Na+-NQR complex is absent in mammals, making it a potential target for antimicrobial development. Compounds that specifically inhibit this complex could potentially disrupt H. influenzae bioenergetics without affecting host cells.

  • Evolutionary insights: The presence of similar Na+-NQR systems in diverse bacteria, from marine organisms to human pathogens, suggests this may represent an ancient and fundamental bioenergetic mechanism that has been adapted for different ecological niches through evolution .

This knowledge contributes to our understanding of how H. influenzae has evolved specialized energy generation mechanisms that may support its lifestyle as both a commensal organism and a serious pathogen causing localized and invasive infections .

What are the implications of nqrE structure and function for development of novel antimicrobial strategies?

The unique properties of nqrE and the Na+-NQR complex present several promising avenues for antimicrobial development:

  • Target specificity: The Na+-NQR complex is absent in mammals, making it an attractive target for selective antimicrobial action with potentially reduced host toxicity. Inhibitors targeting nqrE or other Na+-NQR subunits could specifically disrupt bacterial bioenergetics without affecting mammalian cells.

  • Broad-spectrum potential: The Na+-NQR complex is present in various bacterial pathogens beyond H. influenzae, including Vibrio cholerae and Klebsiella pneumoniae. Inhibitors targeting conserved features of this complex could potentially have broad-spectrum activity against multiple pathogens .

  • Resistance considerations: As an ancient and fundamental bioenergetic mechanism, targeting the Na+-NQR complex might present a higher barrier to resistance development compared to targets with more redundant functions in bacterial physiology.

  • Structure-based drug design opportunities: Understanding the detailed structure of nqrE and its interactions within the Na+-NQR complex can facilitate rational design of inhibitors targeting specific functional domains or protein-protein interfaces critical for complex assembly or function.

  • Combination therapy potential: Inhibitors of Na+-NQR could potentially be synergistic with existing antibiotics by compromising bacterial energy metabolism, thereby enhancing the efficacy of antibiotics that require active processes for uptake or are affected by membrane potential .

These approaches could be particularly valuable given the increasing prevalence of antibiotic resistance and the urgent need for novel antimicrobial strategies targeting fundamental bacterial processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.