Recombinant Haemophilus influenzae Oligopeptide transport system permease protein oppB (oppB)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Function

OppB is a permease subunit of the oligopeptide transporter (Opp) system, which imports peptides 3–16 amino acids long to support bacterial growth and survival . In Haemophilus influenzae, OppB partners with OppC, OppD, OppF, and the substrate-binding protein OppA to form a functional ABC transporter . Key roles include:

  • Peptide Import: Facilitates uptake of oligopeptides as nutrient sources .

  • Structural Contribution: Forms transmembrane channels for substrate translocation .

  • Pathogenic Fitness: Enables survival in host environments by acquiring essential amino acids like arginine .

Recombinant Protein Production

Recombinant OppB is engineered for research applications, with standardized production protocols:

Table 2: Key Applications of Recombinant OppB

ApplicationPurposeReference
Antibiotic DevelopmentTarget validation for disrupting peptide transport in pathogens
Vaccine ResearchAntigen candidate studies (e.g., cross-reactive immune responses)
Structural BiologyMechanistic studies of ABC transporter dynamics
Metabolic StudiesInvestigating nutrient uptake in H. influenzae auxotrophy

Challenges and Future Directions

  • Surface Exposure: OppB’s periplasmic localization limits its utility as a vaccine target compared to outer membrane proteins .

  • Functional Redundancy: H. influenzae may employ alternative transporters (e.g., DppBCDF for glutathione uptake), complicating therapeutic targeting .

  • Structural Data Gap: No resolved 3D structure of OppB exists, necessitating cryo-EM or crystallography studies .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific requests. If you have a preference for a particular format, please indicate your requirement during the order placement. We will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: Our proteins are routinely shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. Should you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
oppB; HI_1123; Oligopeptide transport system permease protein OppB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-306
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
oppB
Target Protein Sequence
MLKFIFKRLLEALPTLFILITFSFFLMRLAPGSPFTSERAYPPEVMANIEAKYHLNEPLY KQYFLYLENLSKGDFGPSFKYKDQSVNDLIASAFPVSIKLGMVAFAFAVVLGVTAGTLAA LNQNSRWDYILMSFSMLGVIMPSFVFAPVLVLIFAIYLGWLPAGGWNGGTAMYMILPVAS LTIAYVAGIARIMRGSMIEVLHSNFIRTAKAKGLSMSRIILKHALRPALLPVITYLGPAF VGIITGSMVIESVFGLPGMGLLFVNGALNRDYSLVLSLTILVGTLTILFNAIVDILYAII DPKIRY
Uniprot No.

Target Background

Function
This protein is a component of the binding-protein-dependent transport system for oligopeptides. It is likely responsible for translocating the substrate across the membrane.
Database Links

KEGG: hin:HI1123

STRING: 71421.HI1123

Protein Families
Binding-protein-dependent transport system permease family, OppBC subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the oligopeptide permease transport system and what role does OppB play?

The oligopeptide permease (Opp) system belongs to the ATP-binding cassette (ABC) transporter superfamily and typically consists of five proteins: OppA, OppB, OppC, OppD, and OppF. OppB functions as one of two permease proteins (alongside OppC) that form the transmembrane channel component of the complex. Together, they create a passage through which oligopeptides can traverse the bacterial membrane after binding to the substrate-binding protein OppA. The ATP hydrolysis required for this transport is facilitated by the ATPase components OppD and OppF .

OppB is encoded within the opp gene cluster, which in many bacteria is highly conserved. PCR analysis across multiple bacterial strains has shown that oppB and other opp genes are present in all tested strains, indicating their fundamental importance to bacterial physiology .

How does the molecular structure of OppB differ between H. influenzae and other bacterial species?

While specific structural information for H. influenzae OppB must be determined experimentally, comparative genomic analyses with similar bacteria like M. catarrhalis show that OppB is typically a membrane protein of approximately 53.6 kDa (477 amino acids in its mature form). The protein contains multiple transmembrane domains characteristic of ABC transporter permeases .

Researchers should note that the full-length OppB can be challenging to express recombinantly due to its hydrophobic transmembrane regions. In experimental studies with M. catarrhalis, only truncated versions of the N-terminal region (amino acids 2-227) have been successfully expressed in E. coli systems, suggesting similar approaches may be necessary for H. influenzae OppB .

What experimental evidence supports the role of OppB in bacterial virulence and survival?

Knockout studies of the opp gene cluster have demonstrated its importance in various bacteria. In M. catarrhalis, mutants with the entire oppBCDFA cluster replaced show altered phenotypes compared to wild-type strains. Validation of these mutants has been confirmed through PCR, sequencing, and immunoblot assays using specific antisera developed against recombinant OppB proteins .

For H. influenzae specifically, researchers should design similar knockout experiments focusing on the oppB gene to establish its role in virulence, biofilm formation, and resistance to host immune responses.

What are the optimal strategies for cloning the oppB gene from H. influenzae?

Based on successful approaches with similar transport proteins, researchers should consider the following methodological approach:

  • PCR amplification of the oppB gene from H. influenzae genomic DNA using primers with appropriate restriction sites (e.g., BamHI and SacI)

  • Restriction digestion of both the PCR product and expression vector

  • Ligation using T4 DNA ligase with optimized vector:insert ratios (e.g., 30 ng vector to 20 ng insert)

  • Transformation into an appropriate E. coli strain

  • Selection on media containing appropriate antibiotics (typically 100 μg/ml spectinomycin or kanamycin)

  • Confirmation of successful cloning by PCR and sequencing

For difficult membrane proteins like OppB, it may be necessary to clone only the N-terminal region or other soluble domains, as full-length expression can be toxic to E. coli .

Why is expressing full-length OppB challenging, and what alternative approaches can be used?

Full-length expression of OppB is challenging due to its multiple hydrophobic transmembrane domains, which can be toxic to E. coli expression systems. Research with similar permease proteins shows that expressing the full-length mature protein is often unsuccessful .

Alternative approaches include:

  • Expression of truncated versions (e.g., the N-terminal 226-amino acid region)

  • Addition of solubility tags (e.g., SUMO, MBP, or GST)

  • Use of specialized E. coli strains designed for membrane protein expression

  • Implementation of cell-free expression systems

  • Codon optimization for improved expression in heterologous systems

When expressing only fragments of OppB, it's crucial to verify that the expressed region contains relevant epitopes for antibody production or functional domains for mechanistic studies.

What expression vector systems and E. coli strains are most effective for recombinant OppB production?

For successful expression of OppB fragments, the following systems have proven effective:

  • Vectors: pET series vectors (particularly pET 100 D-TOPO) incorporating polyhistidine tags for purification

  • E. coli strains: BL21(DE3) for expression and Top10 for initial cloning steps

  • Selection markers: Vectors carrying carbenicillin (100 μg/ml) or kanamycin (30 μg/ml) resistance genes

Expression should be optimized using the following conditions:

  • Medium composition: 5 g/L yeast extract, 5 g/L tryptone, 10 g/L NaCl, 1 g/L glucose

  • Induction at OD600 of 0.8 with 0.1 mM IPTG

  • Post-induction temperature of 25°C for 4 hours

These conditions have been statistically validated to enhance soluble protein expression compared to standard protocols.

What purification strategy yields the highest recovery of functional recombinant OppB?

For OppB fragments containing a polyhistidine tag, the following purification protocol is recommended:

  • Grow transformed E. coli in 100 ml LB broth with appropriate antibiotics

  • Induce expression at optimal OD600 (0.8) with 0.1 mM IPTG

  • After expression, harvest cells by centrifugation and lyse using appropriate buffer

  • Incubate clarified lysate with Ni-NTA resin for 20 minutes at room temperature

  • Wash resin twice with binding buffer

  • Elute protein with elution buffer containing 150 mM imidazole, 50 mM NaH2PO4, 270 mM NaCl, and appropriate denaturant (6 M guanidine chloride for N-terminal OppB fragments)

Protein concentration can be determined using the Lowry assay, with expected yields of approximately 250 mg/L under optimized conditions .

How can the purity and identity of recombinant OppB be verified?

Verification should employ multiple complementary techniques:

  • SDS-PAGE with Coomassie staining: Purified recombinant N-terminal OppB fragments typically appear as single bands of approximately 29 kDa (including histidine tag)

  • Immunoblot analysis: Using specific antisera developed against the recombinant protein

  • Mass spectrometry: For precise molecular weight determination and peptide mapping

  • N-terminal sequencing: To confirm the correct start of the protein sequence

Researchers should be aware that antisera raised against N-terminal fragments may show cross-reactivity with other proteins (approximately 34 kDa in size has been observed in some systems), necessitating additional purification steps for the antisera .

What approaches can be used to develop specific antisera against recombinant OppB?

Based on successful protocols with similar proteins, the following approach is recommended:

  • Immunize New Zealand White rabbits with 250 μg of purified recombinant protein emulsified 1:1 in complete Freund's adjuvant for initial immunization

  • Follow with booster immunizations of 125 μg protein in incomplete Freund's adjuvant every 3 weeks

  • Collect serum 2 weeks after the second or third boost

  • Remove background antibodies by adsorption against knockout mutant bacteria or through affinity purification using CNBr-Sepharose 4B beads

The resulting antisera should be validated by immunoblot against both the recombinant protein and wild-type bacterial lysates, with appropriate knockout mutants serving as negative controls .

How can statistical experimental design improve recombinant OppB expression?

Traditional one-variable-at-a-time approaches often fail to identify optimal expression conditions. Instead, factorial experimental design allows:

  • Simultaneous evaluation of multiple variables

  • Identification of interaction effects between variables

  • Maximization of information from minimal experiments

  • Statistical validation of results

For OppB expression, an 8-variable factorial design incorporating the following factors should be considered:

  • Medium components: yeast extract, tryptone, NaCl, glucose concentrations

  • Induction parameters: IPTG concentration, OD600 at induction, temperature post-induction

  • Antibiotic concentration

This approach can increase soluble protein yield by 3-4 fold compared to standard conditions while reducing the number of required experiments .

What factors most significantly impact the soluble expression of recombinant OppB?

Based on statistical analysis of recombinant membrane protein expression, the most significant factors include:

  • Post-induction temperature: Lower temperatures (25°C) significantly increase soluble protein yield

  • Induction OD600: Induction at higher cell densities (OD600 = 0.8) increases total protein yield

  • IPTG concentration: Lower concentrations (0.1 mM) often improve soluble expression

  • Medium composition: Balanced nutrient compositions with moderate glucose levels prevent inclusion body formation

The interaction between temperature and inducer concentration is particularly significant, with low IPTG concentrations and reduced temperatures working synergistically to improve soluble expression .

How can experimental design be used to optimize OppB functionality rather than just expression levels?

When optimizing for functional protein rather than mere expression levels:

  • Select appropriate response variables that measure functionality (e.g., binding assays, transport activity)

  • Design experiments incorporating both expression conditions and buffer compositions

  • Establish quantitative assays for protein activity

  • Use statistical software to analyze multiple outcomes simultaneously

For membrane proteins like OppB, consider including detergent types and concentrations in your experimental design, as these significantly impact protein functionality after extraction from membranes.

What methods can be employed to assess the functional activity of recombinant OppB?

Since OppB functions as part of a complex transport system, functional assessment requires:

  • Reconstitution experiments: Incorporating purified OppB into liposomes or nanodiscs along with other Opp components

  • Transport assays: Using labeled peptides to measure transport across the reconstituted membranes

  • ATPase activity assays: Measuring ATP hydrolysis when the complete transporter complex is assembled

  • Binding studies: Determining interaction with other Opp components using techniques like surface plasmon resonance or pull-down assays

These functional assays should be combined with structural studies (e.g., circular dichroism) to confirm proper protein folding.

How can site-directed mutagenesis be used to study OppB structure-function relationships?

To elucidate critical functional regions of OppB:

  • Identify conserved amino acid residues through sequence alignment across bacterial species

  • Design mutagenesis primers targeting these conserved regions

  • Create single amino acid substitutions using PCR-based mutagenesis

  • Express and purify the mutant proteins

  • Assess functional changes compared to wild-type protein

  • Correlate mutations with structural predictions from homology modeling

Focus particularly on predicted transmembrane domains and regions that interact with other Opp components, as these are likely crucial for function.

What approaches can be used to study interactions between OppB and other components of the oligopeptide transport system?

To characterize protein-protein interactions within the Opp system:

  • Co-immunoprecipitation: Using antisera against OppB to pull down interacting partners

  • Bacterial two-hybrid assays: For in vivo assessment of protein interactions

  • Cross-linking studies: To capture transient interactions

  • Co-expression experiments: Expressing multiple components simultaneously to facilitate complex formation

  • Cryo-EM or X-ray crystallography: For structural determination of the assembled complex

These approaches can establish the stoichiometry and arrangement of the complete Opp transport system, particularly the interaction between the two permease components OppB and OppC.

What are common challenges in recombinant OppB expression and how can they be addressed?

ChallengePossible CausesSolutions
Low expression levelsProtein toxicity, poor codon usageExpress truncated versions, use codon-optimized sequences, lower IPTG concentration
Inclusion body formationRapid expression, improper foldingLower induction temperature to 25°C, reduce IPTG to 0.1 mM, add solubility tags
Protein degradationProtease activityInclude protease inhibitors, use protease-deficient strains
Poor solubilityHydrophobic transmembrane domainsFocus on soluble domains, add detergents during purification
Low purityNon-specific binding to purification resinOptimize imidazole concentration in wash buffers, use multiple purification steps

For each challenge, implement a systematic approach to identify the specific cause before applying targeted solutions .

How can researchers assess and improve the quality of antisera developed against recombinant OppB?

To ensure high-quality antisera:

  • Evaluate specificity through immunoblotting against both recombinant protein and wild-type bacterial lysates

  • Test cross-reactivity using knockout mutant strains as negative controls

  • Improve specificity through adsorption with knockout strains or affinity purification

  • Determine optimal working dilutions for different applications

  • Assess batch-to-batch variability when producing multiple antisera

Cross-reactive bands (such as the 34 kDa band observed with some OppB antisera) should be carefully documented, as they may affect experimental interpretation .

What control experiments are essential when characterizing recombinant OppB and its function?

Essential controls include:

  • Negative controls: oppB knockout mutants to confirm antibody specificity

  • Positive controls: Wild-type bacterial strains expressing native OppB

  • Vector-only controls: E. coli transformed with empty expression vector

  • Functional redundancy controls: Testing for compensatory mechanisms when OppB is absent

  • Complementation experiments: Reintroducing the oppB gene into knockout mutants to restore function

  • Specificity controls: Testing unrelated membrane proteins to confirm assay specificity

These controls should be systematically incorporated into all experiments to ensure reliable and reproducible results.

How can recombinant OppB be utilized in vaccine development against H. influenzae?

OppB presents potential as a vaccine candidate due to its:

  • Surface accessibility

  • Conservation across strains

  • Role in bacterial virulence

To evaluate OppB as a vaccine candidate:

  • Produce highly purified recombinant protein or fragments

  • Assess immunogenicity in animal models

  • Evaluate protective efficacy against bacterial challenge

  • Determine cross-protection against different H. influenzae strains

  • Study potential adjuvants to enhance immune response

Researchers should focus on epitope mapping to identify immunologically relevant regions that could be incorporated into subunit vaccines.

What approaches can be used to develop inhibitors targeting the H. influenzae Opp transport system?

Strategic approaches include:

  • Structure-based drug design: Using homology models of OppB to identify potential binding sites

  • High-throughput screening: Testing compound libraries for inhibition of transport function

  • Peptide mimetics: Designing molecules that compete with natural substrates

  • Fragment-based screening: Identifying small molecules that bind to specific OppB domains

  • Natural product screening: Evaluating microbial extracts for inhibitory activity

Validation of inhibitors requires functional assays measuring the impact on oligopeptide transport and bacterial growth under various nutritional conditions.

How can researchers assess the role of OppB in H. influenzae pathogenesis?

To establish the contribution of OppB to pathogenesis:

  • Generate precise knockout mutants using homologous recombination

  • Perform complementation studies to confirm phenotypic changes are due to oppB deletion

  • Assess virulence in appropriate animal models

  • Evaluate bacterial survival under various stress conditions

  • Measure growth in media mimicking host environments

  • Study biofilm formation capabilities

  • Examine resistance to host defense mechanisms

Correlating findings from these experiments with clinical isolate characteristics can provide insights into OppB's role in human infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.