Recombinant Haemophilus influenzae Oligopeptide transport system permease protein oppC (oppC)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Haemophilus influenzae Oligopeptide Transport System Permease Protein OppC (OppC)

Recombinant Haemophilus influenzae oligopeptide transport system permease protein OppC (OppC) is a recombinant form of the native OppC permease subunit, a critical component of the bacterial ATP-binding cassette (ABC) transporter system. This system facilitates the uptake of oligopeptides (3–16 amino acids) into bacterial cells, providing essential nutrients for growth and survival in nutrient-limited environments like the human respiratory tract .

Production and Purification of Recombinant OppC

Recombinant OppC is produced via heterologous expression systems, with E. coli being the most common host .

Production Parameters

Host SystemPurityApplications
E. coli≥85%Structural studies, functional assays
Yeast≥85%Post-translational modification studies
Baculovirus/Mammalian≥85%Native conformation preservation

Purification Methods: Affinity chromatography (e.g., His-tag) followed by size-exclusion chromatography .

Peptide Transport Efficiency

OppC’s role in H. influenzae mirrors findings in Moraxella catarrhalis, where the Opp system is critical for:

  • Nutrient Acquisition: Uptake of arginine-rich peptides in minimal media .

  • Pathogen Fitness: Mutants lacking OppA or OppB/C show impaired survival in host models .

Multisubstrate Specificity

While OppA binds peptides, recent studies in H. influenzae suggest:

  • Heme Uptake: Some Opp system components (e.g., OppA orthologs) exhibit dual specificity for peptides and heme .

  • Ligand Binding: Heme and peptides occupy distinct binding pockets, enabling simultaneous nutrient acquisition .

Vaccine Development

While OppC itself is not a primary vaccine target, ABC transporters are explored for:

  • Antimicrobial Targets: Inhibiting peptide uptake may disrupt pathogen nutrition .

  • Adjuvant Research: Opp components may modulate host immune responses .

Antimicrobial Resistance Studies

Opp systems are implicated in:

  • Antibiotic Efflux: ABC transporters may contribute to β-lactam resistance .

  • Nutrient Competition: Depriving pathogens of peptide nutrients via Opp inhibitors .

Challenges and Future Directions

  • Limited Structural Data: No high-resolution crystallography data for H. influenzae OppC exists .

  • Functional Redundancy: Overlapping roles with other transporters (e.g., Dpp system) .

  • Host Specificity: OppC’s role in H. influenzae colonization vs. invasion remains unclear .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we understand that specific requirements may arise. Should you have any preferences regarding the format, kindly specify them when placing your order. We will diligently prepare your order according to your instructions.
Lead Time
Delivery time may vary depending on the purchasing method and location. We kindly request you to consult your local distributors for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing of the product is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference point for your own preparations.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C, while the lyophilized form can be stored for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type in mind, please communicate it to us, and we will prioritize the development of your specified tag.
Synonyms
oppC; HI_1122; Oligopeptide transport system permease protein OppC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
oppC
Target Protein Sequence
MTDYRTQPINQKNADFVEQVADRIEEMQLEGRSLWQDAKRRFFRNKAAVASLIILAFIII FITVAPWFFPFTYEDTDWNMMSAAPTMEGYHFFGTDASGRDLLVRTAIGGRISLLVGIAG AFISVTIGTIYGAISGYVGGKTDMLMMRFLEILSSFPFMFFVILLVTLFGQNIFLIFIAI GAIAWLGLARIVRGQTLSLKNKEFVEAAIVCGVPRRQIILKHIIPNVLGLVAVYASLEVP GLILFESFLSFLGLGTQEPMSSWGALLSDGAAQMEVSPWLLIFPAFFLCLTLFCFNFIGD GLRDALDPKDR
Uniprot No.

Target Background

Function
This protein is an integral component of the binding-protein-dependent transport system for oligopeptides. It is believed to play a crucial role in the translocation of the substrate across the membrane.
Database Links

KEGG: hin:HI1122

STRING: 71421.HI1122

Protein Families
Binding-protein-dependent transport system permease family, OppBC subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What biological roles does oppC play in Haemophilus influenzae pathophysiology?

The oppC protein contributes to several critical aspects of H. influenzae pathophysiology:

  • Nutrient acquisition: By facilitating oligopeptide uptake, oppC helps the bacterium obtain essential amino acids from host environments where free amino acids may be limited. This is particularly important during infection when the bacterium must compete with the host for nutrients.

  • Environmental adaptation: The Opp system enables the bacterium to sense and adapt to changing environmental conditions by importing signaling peptides that can trigger adaptive responses.

  • Virulence regulation: While oppC itself has not been directly implicated in virulence to the extent of adhesins like HMW1 , the Opp transport system may contribute to pathogenicity by:

    • Supporting bacterial growth in nutrient-limited host environments

    • Contributing to biofilm formation, which enhances persistence

    • Potentially importing host-derived peptides that signal the presence of specific host environments

  • Intracellular survival: The ability to import oligopeptides may support intracellular survival of H. influenzae within host cells, similar to the role that HMW1 adhesin plays in intracellular invasion .

  • Cell wall recycling: The Opp system may participate in recycling peptidoglycan fragments, contributing to cell wall integrity and potentially influencing antibiotic susceptibility.

What experimental designs are most appropriate for studying oppC function in H. influenzae?

When investigating oppC function in Haemophilus influenzae, researchers should consider several experimental design approaches based on their specific research questions:

Quasi-Experimental Designs

For studies where complete randomization is not possible (such as with clinical isolates), quasi-experimental approaches provide valuable alternatives:

  • Nonequivalent control group pretest-posttest design: This approach allows comparison of oppC function before and after experimental intervention across different H. influenzae strains. For example, measuring oligopeptide uptake in wild-type and oppC mutant strains before and after exposure to stress conditions .

  • Interrupted time-series design: This design is valuable for tracking changes in oppC expression or function over time in response to environmental shifts, such as monitoring changes in gene expression following antibiotic exposure .

Single-Case Experimental Designs

These designs are particularly useful when working with rare phenotypes or limited samples:

  • Reversal design (A-B-A): This approach allows researchers to establish baseline oppC function (A), observe changes after experimental manipulation (B), and then return to baseline conditions (A) to confirm causality. For example, measuring peptide transport in wild-type bacteria (A), then after temporary oppC repression (B), and again after allowing re-expression (A) .

  • Multiple-baseline design: This design staggers the introduction of experimental variables across different strains or conditions, allowing researchers to differentiate between experimental effects and coincidental changes .

Recombinant DNA-Based Approaches

Advanced molecular techniques offer powerful tools for oppC functional studies:

  • Transformed Recombinant Enrichment Profiling (TREP): This approach allows researchers to generate pools of recombinants with various oppC alleles, select for specific phenotypes, and use deep sequencing to identify enriched genetic variants. This technique has been successfully applied to H. influenzae to identify factors involved in intracellular invasion .

  • Gene knockout and complementation: Create precise oppC deletion mutants and complement with either native or variant oppC genes to assess functional consequences.

The selection of an appropriate experimental design should be guided by the specific research question, available resources, and the need to control for confounding variables in H. influenzae research.

How should researchers design controls for experiments involving recombinant oppC?

Designing appropriate controls is critical for experiments involving recombinant oppC to ensure valid and interpretable results. A comprehensive control strategy should include:

Genetic Controls

  • Empty vector control: Cells transformed with the expression vector lacking the oppC insert, essential for distinguishing effects of oppC from those caused by the vector or expression system itself.

  • Wild-type oppC control: The native oppC from the strain under study serves as a positive control for normal function.

  • Inactive mutant control: oppC with mutations in key functional residues (e.g., conserved transmembrane domains) helps distinguish between specific and non-specific effects.

  • Deletion strain control: H. influenzae with oppC deleted establishes baseline phenotypes in the complete absence of the protein.

  • Complemented deletion control: The oppC deletion strain complemented with wild-type oppC confirms that observed phenotypes are specifically due to oppC rather than polar effects or secondary mutations.

Experimental Controls

  • Non-induced expression control: For inducible expression systems, samples containing the oppC construct but not induced with the inducer.

  • Specificity controls: Include testing related but distinct transporters (e.g., other ABC transporters) to confirm specificity of observed effects.

  • Environmental controls: Since oppC function may be influenced by growth conditions, maintaining consistent temperature, pH, media composition, and growth phase is essential.

Statistical and Methodological Controls

  • Technical replicates: Multiple measurements of the same biological sample to assess measurement precision.

  • Biological replicates: Independent cultures or transformations to account for biological variability.

  • Time-matched controls: Particularly important for time-series experiments to control for time-dependent effects unrelated to the experimental variable.

For quasi-experimental designs as described in search result , researchers should also consider:

  • Multiple baseline measurements to establish stability before intervention

  • Reversal phases to demonstrate causality in single-case designs

  • Appropriate statistical analyses that account for the specific design used

By implementing this comprehensive control strategy, researchers can increase confidence in their findings regarding oppC function and avoid misinterpretations due to experimental artifacts.

What approaches can be used to express and purify recombinant oppC for functional studies?

Expressing and purifying recombinant oppC presents unique challenges due to its multiple transmembrane domains. A methodological approach includes:

Expression System Selection

  • Bacterial expression systems:

    • E. coli C43(DE3) or Lemo21(DE3): Specialized strains designed for membrane protein expression

    • H. influenzae: Homologous expression may preserve native folding but typically yields lower protein amounts

  • Cell-free expression systems:

    • Beneficial for toxic membrane proteins

    • Allows immediate addition of detergents or lipids during synthesis

  • Eukaryotic systems:

    • Insect cells (Sf9, High Five) with baculovirus vectors

    • Yeast systems (Pichia pastoris) for complex membrane proteins

Construct Design Considerations

  • Affinity tags:

    • C-terminal tags are generally preferred since N-terminal tags may interfere with membrane insertion

    • Common options: His6, His8, FLAG, or Strep-II tag

    • Consider TEV or PreScission protease cleavage sites for tag removal

  • Fusion partners:

    • Maltose-binding protein (MBP) or thioredoxin can enhance solubility

    • Green fluorescent protein (GFP) allows monitoring of expression and folding quality

Expression Optimization

ParameterVariables to TestComments
Temperature18°C, 25°C, 30°CLower temperatures often improve folding
Inducer concentrationIPTG: 0.1-1.0 mMLower concentrations may reduce aggregation
MediaLB, TB, M9, auto-inductionRich media can increase yield but may reduce quality
AdditivesGlycerol (5-10%), glucose (0.5-1%)Can stabilize membrane proteins
Induction time3h, 6h, overnightLonger times may increase yield but can reduce quality

Purification Strategy

  • Membrane extraction:

    • Carefully selected detergents are critical (DDM, LDAO, or Triton X-100)

    • Consider detergent screening to identify optimal solubilization conditions

  • Purification steps:

    • Initial IMAC (immobilized metal affinity chromatography) for His-tagged constructs

    • Ion exchange chromatography as an intermediate step

    • Size exclusion chromatography as a final polishing step and to assess homogeneity

  • Quality control:

    • SDS-PAGE and Western blotting to confirm identity and purity

    • Circular dichroism to assess secondary structure

    • Dynamic light scattering to check for aggregation

    • Activity assays to verify functional state

This methodological approach should be optimized for oppC specifically, with careful attention to maintaining the protein's native structure and function throughout the purification process.

How can natural transformation be utilized to study oppC variants in Haemophilus influenzae?

Haemophilus influenzae is naturally competent for DNA uptake, making natural transformation an excellent approach for studying oppC variants. Based on the Transformed Recombinant Enrichment Profiling (TREP) methodology described in search result , researchers can employ the following methodological strategy:

Preparation of Donor DNA

  • Source selection:

    • Clinical isolates with diverse oppC alleles

    • Synthetic oppC variants with specific mutations

    • PCR-amplified oppC from related species

  • DNA preparation:

    • PCR amplification with high-fidelity polymerase to minimize errors

    • Include 500-1000 bp of flanking sequence on each side to facilitate homologous recombination

    • Purify DNA to remove potential inhibitors of transformation

Recipient Strain Development

  • Selection of appropriate background strains:

    • Laboratory strains (e.g., Rd KW20) with well-characterized genetics

    • Clinical isolates representing different genetic backgrounds

    • Strains with reporters linked to oppC function

  • Creation of marker strains:

    • Generate oppC deletion mutants as recipients for complementation

    • Create strains with selectable markers flanking the oppC locus

    • Develop reporter systems to monitor oppC activity

Transformation Protocol

  • Competence induction:

    • Grow H. influenzae to early log phase (OD600 ~0.2-0.3)

    • Transfer to MIV medium (a nutrient-limited medium that induces competence)

    • Incubate for 100 minutes at 37°C to develop maximum competence

  • Transformation:

    • Add 1 μg/ml of donor DNA to competent cells

    • Incubate for 30 minutes to allow DNA uptake

    • Add DNase I to degrade extracellular DNA

    • Allow 60-90 minutes for expression of transformed genes

    • Plate on selective media if appropriate markers are used

  • TREP approach for complex analyses:

    • Transform with pools of oppC variants

    • Apply selection pressures related to oppC function

    • Use deep sequencing to identify enriched variants

Verification and Analysis

  • PCR screening:

    • Design primers specific to introduced variants

    • Screen multiple colonies to identify successful transformants

  • Sequence confirmation:

    • Sequence the oppC locus to confirm the presence of desired variants

    • Check for unexpected mutations that might have occurred during transformation

  • Functional analysis:

    • Assess oligopeptide transport efficiency

    • Measure growth in media with oligopeptides as sole nitrogen source

    • Evaluate contribution to stress resistance

Similar to how TREP identified HMW1 adhesin as crucial for H. influenzae intracellular invasion , this approach could identify specific oppC variants or domains critical for oligopeptide transport function, substrate specificity, or contribution to virulence.

What regulatory requirements must researchers address when working with recombinant H. influenzae oppC?

Researchers working with recombinant Haemophilus influenzae oppC must navigate several regulatory requirements to ensure compliance and safety:

Institutional Biosafety Committee (IBC) Approval

According to search result , work with recombinant or synthetic nucleic acid molecules requires IBC review and approval, including:

  • Application requirements:

    • Detailed description of recombinant constructs

    • Risk assessment for all procedures

    • Containment measures and safety protocols

    • Personnel training documentation

  • Specific considerations for oppC work:

    • Whether oppC constructs will be expressed in H. influenzae or heterologous hosts

    • Potential impact on bacterial virulence or transmissibility

    • Safety measures for handling potentially infectious recombinant bacteria

NIH Guidelines Compliance

The NIH Guidelines define several categories of recombinant DNA research based on risk level:

  • Risk assessment factors:

    • H. influenzae is typically considered Risk Group 2

    • oppC itself is not a virulence factor but could potentially alter bacterial behavior

    • Expression systems and vectors used must be evaluated for containment

  • Containment levels:

    • Most work with H. influenzae requires BSL-2 containment

    • Additional containment might be required if oppC modifications could enhance pathogenicity

Documentation and Training Requirements

  • Laboratory documentation:

    • Standard Operating Procedures (SOPs) for all recombinant DNA procedures

    • Records of all transformations and constructs generated

    • Incident reporting protocols

  • Personnel requirements:

    • Documented training in recombinant DNA techniques

    • Bloodborne pathogen training for work with H. influenzae

    • Specific training for any specialized equipment or procedures

Material Transfer Considerations

  • Receiving materials:

    • Material Transfer Agreements (MTAs) for oppC constructs from other institutions

    • Import permits if materials come from international sources

  • Sharing materials:

    • Export controls for international transfers

    • MTAs for sharing with collaborators

    • Appropriate biosafety documentation accompanying all transfers

Special Considerations for Clinical Samples

If oppC variants are derived from clinical isolates of H. influenzae:

  • IRB approval may be required for use of clinical samples

  • Patient consent and privacy considerations

  • Additional biosafety measures for potentially infectious clinical strains

Compliance with these regulatory requirements is essential not only for legal reasons but also to ensure the safety of research personnel and the environment. Researchers should consult with their institutional biosafety officers early in project planning to ensure all requirements are addressed appropriately.

How should researchers address potential data contradictions when studying oppC function across different experimental systems?

Researchers frequently encounter contradictory results when studying oppC function across different experimental systems. A methodological approach to addressing these contradictions includes:

Systematic Evaluation of Experimental Variables

  • Strain background differences:

    • Laboratory strains vs. clinical isolates

    • Presence of compensatory mutations

    • Genetic lineage and evolution of test strains

  • Expression system variations:

    • Native expression vs. recombinant systems

    • Protein tag effects on function

    • Expression level differences

  • Growth condition disparities:

    • Media composition effects on oppC expression

    • Growth phase considerations

    • Temperature, pH, and oxygen availability

Data Analysis and Reconciliation Approaches

  • Meta-analysis techniques:

    • Systematic review of published data

    • Statistical re-analysis using consistent methods

    • Weighting studies based on methodological robustness

  • Experimental design review:

    • Assess whether quasi-experimental designs might have introduced biases

    • Evaluate control adequacy across studies

    • Consider sample size and statistical power

  • Direct experimental comparison:

    • Design experiments specifically to test hypotheses about sources of contradiction

    • Include multiple strains or conditions in single experiments

    • Use multiple complementary techniques to measure the same parameter

Reconciliation Strategy Example

Contradiction TypeInvestigation ApproachResolution Strategy
Different oppC substrate specificity between strainsSequence comparison, domain swappingIdentify specific residues responsible for specificity differences
Inconsistent growth phenotypes in oppC mutantsStandardize media, growth conditionsDevelop minimal media formulation that reveals consistent phenotypes
Varying contribution to virulenceUse identical infection modelsDefine condition-specific roles in pathogenesis
Contradictory protein interaction partnersCompare tagged vs. untagged approachesImplement multiple orthogonal interaction detection methods

Implementation Plan

  • Establish a standardized experimental framework:

    • Define core methodologies and controls

    • Create a panel of reference strains accessible to all researchers

    • Develop standard reporting formats for oppC functional data

  • Collaborative approach:

    • Form working groups with researchers reporting contradictory results

    • Conduct parallel experiments in multiple laboratories

    • Share raw data and detailed protocols

  • Systems biology perspective:

    • Consider that contradictions may reflect biological reality

    • Map condition-specific regulatory networks affecting oppC

    • Develop predictive models incorporating context-dependency

By adopting this methodological approach, researchers can transform contradictions from frustrations into valuable insights about the context-dependent nature of oppC function, ultimately developing a more nuanced understanding of how this transporter operates under different conditions.

How can oppC be utilized as a model system for studying membrane protein topology and assembly?

The oppC protein, with its multiple transmembrane domains, provides an excellent model system for studying membrane protein topology and assembly. A methodological approach includes:

Topology Mapping Techniques

  • Cysteine accessibility methods:

    • Systematically replace residues with cysteine throughout the protein

    • Determine accessibility using membrane-impermeable thiol-reactive reagents

    • Map exposed vs. buried residues to define membrane topology

  • Reporter fusion analysis:

    • Create systematic fusions with reporter proteins (GFP, PhoA, LacZ)

    • PhoA is active only in the periplasm, while GFP folds properly in the cytoplasm

    • Activity patterns reveal topological organization

  • Protease accessibility:

    • Expose intact cells or spheroplasts to proteases

    • Determine which regions are protected vs. accessible

    • Analysis by mass spectrometry to identify cleavage sites

Assembly Mechanism Investigation

  • Pulse-chase experiments:

    • Label newly synthesized oppC with radioactive amino acids

    • Chase with non-radioactive amino acids

    • Follow incorporation into membranes and complex formation over time

  • Interaction with assembly machinery:

    • Crosslinking studies to capture interactions with SecYEG translocon

    • Co-immunoprecipitation with chaperones and insertases

    • Ribosome profiling to assess translation rates and pausing

  • In vitro reconstitution:

    • Cell-free translation in the presence of liposomes or nanodiscs

    • Assessment of insertion efficiency with different membrane compositions

    • Analysis of folding intermediates

Advanced Structural Approaches

  • Hydrogen-deuterium exchange mass spectrometry:

    • Probe solvent accessibility of different protein regions

    • Map conformational changes during transport cycle

    • Identify dynamic domains and stable core regions

  • Electron paramagnetic resonance (EPR) spectroscopy:

    • Introduce spin labels at specific positions

    • Measure distances between labeled residues

    • Determine conformational states in membrane environment

  • Cryo-electron microscopy:

    • Visualize oppC in complex with other Opp components

    • Capture different conformational states

    • Resolve high-resolution structural details

This methodological approach not only advances our understanding of oppC specifically but contributes to the broader field of membrane protein biology, addressing fundamental questions about how polytopic membrane proteins achieve their native structure and function within the lipid bilayer.

What is the relationship between oppC and antimicrobial resistance in H. influenzae clinical isolates?

The relationship between oppC and antimicrobial resistance in Haemophilus influenzae represents an emerging area of research with potential clinical significance. A methodological investigation of this relationship includes:

Direct Mechanisms of Resistance

  • Substrate specificity and antimicrobial peptides:

    • Assess whether oppC can transport antimicrobial peptides into the cell

    • Compare susceptibility to antimicrobial peptides between wild-type and oppC mutants

    • Determine if oppC variants affect susceptibility patterns

  • Exclusion of antibiotic compounds:

    • Investigate if oppC mutations affect membrane permeability

    • Measure uptake of labeled antibiotics in different oppC backgrounds

    • Assess synergy between oppC mutations and known resistance mechanisms

Indirect Contributions to Resistance

  • Nutritional adaptation during antibiotic stress:

    • Compare growth of oppC mutants vs. wild-type in nutrient-limited media with antibiotics

    • Assess if oligopeptide uptake provides metabolic flexibility during antibiotic stress

    • Determine if specific peptides can enhance antibiotic tolerance

  • Biofilm formation and persistence:

    • Evaluate the contribution of oppC to biofilm formation

    • Compare antibiotic tolerance in biofilms formed by wild-type vs. oppC mutants

    • Assess whether oppC affects persister cell formation

  • Stress response modulation:

    • Analyze transcriptomic responses to antibiotics in oppC mutants

    • Determine if oppC affects activation of stress response pathways

    • Assess potential cross-talk with other resistance mechanisms

Clinical Correlation Studies

  • Sequence analysis of clinical isolates:

    • Compare oppC sequences from susceptible and resistant clinical isolates

    • Identify polymorphisms associated with resistance phenotypes

    • Use TREP methodology to identify functional impacts of natural variants

  • Expression analysis:

    • Measure oppC expression levels in resistant vs. susceptible isolates

    • Determine if antibiotic exposure alters oppC expression

    • Assess correlation between oppC expression and minimum inhibitory concentrations

  • Genetic association studies:

    • Perform genome-wide association studies including oppC variants

    • Evaluate epistatic interactions between oppC and known resistance genes

    • Develop predictive models incorporating oppC status

By applying this methodological approach, researchers can clarify both direct and indirect contributions of oppC to antimicrobial resistance in H. influenzae, potentially revealing new targets for antimicrobial development or approaches to overcome existing resistance mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.