Recombinant Haemophilus influenzae Peptide transport system permease protein sapC (sapC)

Shipped with Ice Packs
In Stock

Description

Antimicrobial Peptide Resistance

The Sap transporter binds APs via the periplasmic protein SapA and translocates them into the cytoplasm via the SapBC channel for degradation . Key findings:

  • AP Resistance: Deletion of sapBC in H. ducreyi increased LL-37 sensitivity by >50% compared to wild-type strains .

  • Virulence Attenuation: sapBC mutants of H. ducreyi showed complete loss of pustule formation in human infection models .

Potassium Homeostasis

SapC collaborates with SapD to mediate potassium uptake, essential for bacterial survival under ion-limited conditions :

  • sapD mutants of H. influenzae exhibited growth defects in low-potassium media and reduced virulence in otitis media models .

  • Complementation restored potassium uptake and AP resistance .

Heme Utilization

SapA binds heme, but SapBC permeases are required for cytoplasmic transport :

  • H. influenzae sapBC mutants failed to utilize heme as an iron source under iron-starved conditions .

Applications of Recombinant SapC

  • Antimicrobial Development: Targeting SapBC disrupts AP resistance and heme acquisition, offering a therapeutic strategy .

  • Biochemical Assays: Recombinant SapC enables functional studies of transporter dynamics and substrate interactions .

Research Challenges and Future Directions

  • Structural Dynamics: High-resolution structures of full SapBCDF complexes are needed to elucidate transport mechanisms .

  • Therapeutic Targeting: Small-molecule inhibitors of SapBC could potentiate host innate immunity against Haemophilus infections .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
sapC; HI_1640; Peptide transport system permease protein SapC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-295
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
sapC
Target Protein Sequence
MQNKEPDEFRESTSIFQIWLRFRQNTIALFSFYLLIALIFTALFASYLAPYADNRQFIGQ ELMPPSWVDRGKIAFFFGTDDLGRDILSRLIMGTRYTLGSALLVVFSVAIIGGALGIIAG LLKGIKARFVGHIFDAFLSLPILLIAVVISTLMEPSLWNAMFATLLAILPYFIHTIYRAI QKELEKDYVVMLKLEGISNQALLKSTILPNITVIYIQEVARAFVIAVLDISALSFISLGA QRPTPEWGAMIKDSLELLYLAPWTVLLPGFAIIFTILLSIIFSNGLTKAINQHQE
Uniprot No.

Target Background

Function
This protein plays a role in a peptide intake transport system, contributing to resistance against antimicrobial peptides.
Database Links

KEGG: hin:HI1640

STRING: 71421.HI1640

Protein Families
Binding-protein-dependent transport system permease family, OppBC subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Sap transporter system in Haemophilus influenzae?

The Sap (sensitivity to antimicrobial peptides) transporter is an essential ATP-binding cassette (ABC) transport system found in various bacterial species including Escherichia coli, Salmonella, Vibrio, Pasteurella, Erwinia, Actinobacillus, and Haemophilus species. In nontypeable Haemophilus influenzae (NTHI), the Sap system plays a dual critical role in both antimicrobial peptide (AP) resistance and heme utilization. This transporter provides a mechanism of resistance to antimicrobial peptides, which are key components of host innate immunity with significant bactericidal activity. The system functions by binding antimicrobial peptides through the SapA component, signaling increased sap gene expression, and subsequently enhancing bacterial AP resistance .

What specific role does SapC play within the Sap transporter complex?

SapC functions as one of the integral membrane permease components of the Sap transporter complex. As part of the translocator permease, SapC forms a channel through which substrates (antimicrobial peptides and heme) are transported across the bacterial cytoplasmic membrane. Research has demonstrated that the Sap translocator permease mediates heme transport into the bacterial cytoplasm, defining a previously unknown mechanism of intracytoplasmic membrane heme transport in Haemophilus . SapC works in conjunction with other Sap components to facilitate this essential transport function.

How is the Sap system structurally organized?

The Sap transporter system consists of multiple protein components working together. SapA functions as the periplasmic substrate-binding protein, which shares homology with the dipeptide-binding protein (DppA) and the heme-binding lipoprotein (HbpA). The permease complex includes SapB and SapC, which form the membrane translocation channel. The system also includes ATPase components that provide energy for substrate transport. This organized complex enables both antimicrobial peptide binding and heme transport functions critical for NTHI survival .

How does the Sap system mediate antimicrobial peptide resistance?

The Sap transporter provides a sophisticated mechanism of AP resistance. SapA directly binds antimicrobial peptides in the periplasmic space, which triggers increased expression of sap genes. This enhanced expression strengthens the bacterial AP resistance phenotype . The permease components, including SapC, then facilitate the translocation of these bound APs across the cytoplasmic membrane, effectively removing them from their site of action and preventing membrane disruption. This mechanism is essential for NTHI survival in vivo, as APs typically exert their bactericidal effects by inserting into and disrupting bacterial membranes, disrupting membrane potential and electrochemical gradients .

What is the relationship between the Sap system and heme utilization in H. influenzae?

Haemophilus influenzae cannot synthesize heme de novo and must acquire it from the host environment for survival. Research has revealed that SapA can bind heme, and the Sap translocator permease (which includes SapC) mediates heme transport into the bacterial cytoplasm. This dual functionality equips H. influenzae with the ability to respond to iron limitation while simultaneously providing a mechanism to resist antimicrobial peptide lethality. This is particularly significant as iron limitation often occurs concomitantly with increased antimicrobial peptide exposure during host immune responses .

What experimental evidence supports SapA's role in heme binding?

Computational modeling has revealed conserved SapA residues that are similarly modeled to mediate heme binding in HbpA (heme-binding lipoprotein). Direct experimental evidence has shown that recombinant SapA [(r)SapA] binds heme, and a SapA-deficient strain was unable to utilize heme for growth following iron starvation. These findings provide strong support for SapA's role in heme binding and the Sap system's function in heme utilization .

What approaches are effective for expressing recombinant Sap proteins?

Based on related research with recombinant proteins, successful expression can be achieved using bacterial expression systems. For example, in the case of Candida albicans Sap2 (a secreted aspartyl proteinase), researchers employed the pDS56/RBSII-6xhis/E− vector system in E. coli, which uses a phage T5 promoter tightly regulated by two lac operators and a synthetic ribosome-binding site . This approach can be adapted for SapC expression. Key considerations include:

  • Selection of a suitable expression vector with a strong, inducible promoter

  • Addition of purification tags (such as 6xhis-tag) to facilitate protein isolation

  • Optimization of induction conditions (temperature, inducer concentration, duration)

  • Verification of protein expression through SDS-PAGE and Western blotting

What purification strategies are recommended for Sap proteins?

For his-tagged recombinant Sap proteins, nickel-chelate affinity chromatography provides an efficient one-step purification method. This approach has been successfully used for other recombinant proteins, yielding high purity preparations suitable for immunological and functional studies . The purification process should include:

  • Cell lysis under native or denaturing conditions depending on protein solubility

  • Binding to Ni-NTA resin

  • Washing to remove non-specifically bound proteins

  • Elution with increasing imidazole concentrations

  • Verification of purity using SDS-PAGE and Western blotting with specific antibodies

How can researchers verify the identity and functionality of recombinant SapC?

Verification of recombinant SapC should employ multiple complementary approaches:

Verification MethodPurposeExpected Result
SDS-PAGESize verificationSingle band at predicted molecular weight
Western blottingIdentity confirmationPositive reaction with anti-SapC antibodies
Mass spectrometrySequence verificationPeptide matches to SapC sequence
Functional assaysActivity assessmentReconstituted heme transport in deficient strains

Additionally, researchers can develop specific monoclonal antibodies against the recombinant protein to facilitate detection and functional studies, as demonstrated with other recombinant proteins .

What methods are appropriate for studying SapC-mediated transport mechanisms?

To study SapC-mediated transport mechanisms, researchers can employ various approaches:

  • Gene knockout studies: Creating SapC-deficient strains and assessing their ability to utilize heme and resist antimicrobial peptides

  • Complementation experiments: Reintroducing wild-type or mutated SapC to deficient strains to restore function

  • Transport assays: Using labeled substrates (fluorescently tagged heme or antimicrobial peptides) to measure transport across membranes

  • Liposome reconstitution: Incorporating purified SapC into artificial membrane systems to study transport in isolation

  • Site-directed mutagenesis: Identifying critical residues by creating targeted mutations and assessing functional changes

These approaches can help elucidate the specific role of SapC in the transport process and identify critical structural features necessary for function .

How can researchers investigate interactions between SapC and other Sap components?

Investigation of protein-protein interactions within the Sap system can be approached through:

  • Co-immunoprecipitation: Using antibodies against SapC to pull down associated proteins

  • Bacterial two-hybrid systems: Assessing direct protein interactions in vivo

  • Cross-linking studies: Chemically cross-linking interacting proteins followed by mass spectrometry

  • Surface plasmon resonance: Measuring binding kinetics between purified components

  • FRET analysis: Examining proximity of fluorescently labeled Sap components

Understanding these interactions is crucial for elucidating the complete functional mechanism of the Sap transporter system .

How can the Sap system be targeted for antimicrobial development?

Given the importance of the Sap system for H. influenzae survival, it presents a promising target for antimicrobial development. Potential strategies include:

  • Development of small molecule inhibitors that block SapC permease function

  • Design of peptide mimetics that compete with heme binding

  • Creation of antibodies that interfere with Sap complex assembly

  • Combination approaches targeting both heme acquisition and antimicrobial peptide resistance functions

Inhibition of the Sap system could potentially render H. influenzae more susceptible to host immune defenses and conventional antibiotics .

What role does the Sap system play in H. influenzae pathogenesis?

The Sap system contributes significantly to H. influenzae pathogenesis through:

  • Antimicrobial peptide resistance: Enabling bacterial survival in the presence of host defensive peptides

  • Heme acquisition: Facilitating iron acquisition in the iron-limited host environment

  • In vivo survival: Supporting bacterial persistence during infection

  • Virulence: Contributing to disease manifestations in the human airway

These functions make the Sap system integral to the organism's ability to establish and maintain infection, particularly in diseases of the human respiratory tract .

How is the Sap system genetically regulated in H. influenzae?

The genetic regulation of the Sap system involves complex mechanisms responsive to environmental cues:

  • Iron limitation: May enhance expression of sap genes to facilitate heme acquisition

  • Antimicrobial peptide exposure: Triggers increased transcription of sap genes

  • SapA-mediated signaling: Binding of antimicrobial peptides to SapA signals increased sap gene expression

  • Transcriptional regulators: Likely involves specific transcription factors responsive to stress conditions

Understanding this regulation provides insights into how H. influenzae adapts to changing host environments during infection .

What evolutionary significance does the dual function of the Sap system have?

The dual functionality of the Sap system (antimicrobial peptide resistance and heme utilization) represents an elegant evolutionary adaptation. This system allows H. influenzae to simultaneously address two critical challenges in the host environment: defense against immune effectors and acquisition of essential nutrients. This functional convergence in a single transport system likely provides a selective advantage by economizing genetic and metabolic resources while effectively supporting pathogenesis .

How can transformed recombinant enrichment profiling be applied to study Sap system genetics?

Transformed recombinant enrichment profiling (TREP) represents an advanced approach for investigating genetic variation associated with specific phenotypes. For studying the Sap system, TREP could be applied by:

  • Generating pools of recombinants through natural transformation

  • Selecting for specific phenotypes related to Sap function (antimicrobial peptide resistance or heme utilization)

  • Using deep sequencing to identify genetic variations associated with these phenotypes

This approach would allow researchers to map the genetic architecture underlying Sap system function and identify novel genetic determinants that influence its activity in H. influenzae .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.