Recombinant Haemophilus influenzae Peptidyl-prolyl cis-trans isomerase D (ppiD)

What is the basic structural classification of Haemophilus influenzae ppiD?

Haemophilus influenzae peptidyl-prolyl cis-trans isomerase D (ppiD) is a transmembrane protein belonging to the rotamase family with EC number 5.2.1.8. The full-length protein consists of 622 amino acids with a characteristic N-terminal transmembrane domain, followed by multiple periplasmic domains. The protein contains specific sequence motifs that are conserved among PPIase enzymes, which are critical for its isomerase activity in catalyzing the cis-trans isomerization of proline peptide bonds in target proteins. The amino acid sequence includes characteristic regions such as MLIEKMHNLTNSKISKFILGLIAVSFLVGGMSGYLFSSNDTYAAKVNGEVISQQD and other segments that form its functional domains.

What is the physiological role of ppiD in Haemophilus influenzae?

Peptidyl-prolyl cis-trans isomerase D functions primarily in protein folding and quality control pathways in Haemophilus influenzae. As a membrane-anchored periplasmic folding catalyst, ppiD assists in the proper folding of secreted and membrane proteins as they transit from the cytoplasm to the periplasmic space. It catalyzes the cis-trans isomerization of proline peptide bonds, which is often a rate-limiting step in protein folding. Additionally, ppiD likely functions in coordination with other periplasmic chaperones in the quality control system that prevents misfolded proteins from accumulating in the cell envelope. Its absence may lead to decreased viability under stress conditions, suggesting a role in stress response mechanisms.

How does the sequence of H. influenzae ppiD compare to homologs in other bacterial species?

The sequence alignment analysis of Haemophilus influenzae ppiD (UniProt P44092) reveals significant conservation patterns across diverse bacterial species, particularly among gamma-proteobacteria. The transmembrane domain (amino acids 1-24) shows moderate conservation, while the PPIase domain exhibits high conservation, especially in the catalytic residues. Comparative analysis indicates approximately 45-55% sequence identity with Escherichia coli ppiD and 30-40% identity with similar proteins in Pseudomonas species. The protein contains unique sequence features that distinguish it from other PPIases, including specific insertions in the chaperone domain regions that may confer substrate specificity unique to Haemophilus. These differences may reflect adaptation to specific physiological requirements within the Haemophilus genus.

What expression system is optimal for producing functional recombinant H. influenzae ppiD?

The optimal expression system for producing functional recombinant H. influenzae ppiD is an E. coli-based system, as demonstrated in the product datasheet. For research applications requiring high yields of properly folded protein, BL21(DE3) or similar E. coli strains are preferred due to their reduced protease activity. Expression should be conducted using vectors containing strong inducible promoters (T7 or tac) with careful optimization of induction parameters.

For experimental protocols, the following expression conditions typically yield optimal results:

As ppiD is a transmembrane protein, special consideration should be given to membrane extraction protocols using mild detergents to maintain native conformation during purification.

What purification strategy yields the highest purity and activity of recombinant ppiD?

A multi-step purification strategy is essential for obtaining high-purity, active recombinant ppiD. The recommended approach begins with immobilized metal affinity chromatography (IMAC) utilizing the N-terminal 10xHis-tag, followed by size exclusion chromatography for removing aggregates and contaminants.

Detailed purification protocol:

• Cell lysis: Sonication or French press in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1% mild detergent (e.g., n-dodecyl-β-D-maltoside), and protease inhibitors.

• IMAC purification: Load cleared lysate on Ni-NTA column, wash with 20-50 mM imidazole, and elute with 250-300 mM imidazole.

• Size exclusion chromatography: Using Superdex 200 column in buffer containing 20 mM Tris-HCl pH 7.5, 150 mM NaCl, and 0.05% detergent.

Activity assessment after purification is critical and can be performed using standard PPIase assays with chromogenic substrates. Typical yields from 1L of E. coli culture range from 2-5 mg of purified protein, with specific activity measurements >1000 nmol/min/mg when properly folded.

How can researchers troubleshoot low expression yields of ppiD?

When encountering low expression yields of recombinant ppiD, researchers should systematically evaluate and optimize multiple parameters:

For transmembrane proteins like ppiD, expression as fusion proteins with solubility-enhancing partners (MBP, SUMO) can dramatically improve yields. Additionally, in cases of protein toxicity to the host, utilizing tightly regulated expression systems with minimal basal expression is recommended. Periplasmic targeting may also improve proper folding, though yields may be lower compared to cytoplasmic expression.

What are the recommended protocols for assessing ppiD enzymatic activity?

For rigorous assessment of ppiD enzymatic activity, researchers should employ a combination of spectrophotometric and fluorescence-based assays that monitor the cis-trans isomerization of proline-containing peptides. The standard chymotrypsin-coupled assay is most widely used due to its reliability and quantitative precision.

Protocol details:

• Substrate preparation: Use synthetic tetrapeptides (e.g., Suc-Ala-Xaa-Pro-Phe-pNA, where Xaa represents various amino acids) at 100 μM in assay buffer.

• Reaction conditions: 35 mM HEPES buffer (pH 7.8), 10-50 nM purified ppiD, at 10°C.

• Measurement: Monitor absorbance increase at 390 nm after adding α-chymotrypsin (final concentration 1.25 mg/mL).

• Kinetic analysis: Calculate kcat/Km values using first-order rate equations that account for the uncatalyzed isomerization rate.

For more sensitive measurements, particularly with low enzyme concentrations, a fluorescence-based assay using Abz-Ala-Xaa-Pro-Phe-pNA substrates can provide detection limits approximately 10-fold lower than the spectrophotometric method. Researchers should include appropriate controls including catalytically inactive ppiD mutants and measurements in the presence of known PPIase inhibitors such as cyclosporin A or FK506, although these may have limited effects on ppiD compared to other PPIases.

What structural analysis techniques provide the most insight into ppiD conformation?

A multi-technique approach yields the most comprehensive structural insights into ppiD conformation:

For membrane proteins like ppiD, detergent selection is critical for structural studies. Mild detergents such as DDM, LMNG, or nanodisc reconstitution methods help maintain native conformation. When analyzing specific domains, a divide-and-conquer approach using individual recombinant domains may overcome challenges associated with the full-length transmembrane protein. For dynamics studies, NMR spectroscopy of isotopically labeled domains can provide valuable insights into catalytic mechanisms.

How can researchers effectively analyze ppiD-substrate interactions?

Analysis of ppiD-substrate interactions requires a combination of binding assays and functional studies to elucidate both affinity and catalytic parameters. Recommended methodologies include:

• Surface Plasmon Resonance (SPR): Immobilize His-tagged ppiD on Ni-NTA sensor chips and flow potential substrate proteins to determine binding kinetics (kon, koff) and equilibrium constants (KD).

• Isothermal Titration Calorimetry (ITC): Provides thermodynamic parameters (ΔH, ΔS, ΔG) of binding interactions without requiring protein modification.

• Microscale Thermophoresis (MST): Allows measurement of interactions in solution with minimal protein consumption.

• Cross-linking coupled with mass spectrometry: Identifies specific interaction sites between ppiD and substrates.

• Enzyme kinetics with various substrates: Determine specificity constants (kcat/Km) for different proline-containing peptides to establish substrate preference profiles.

Data interpretation should account for the catalytic mechanism of ppiD, where binding affinity may not directly correlate with catalytic efficiency. Researchers should generate substrate specificity profiles using a panel of peptides with varying amino acids adjacent to the target proline residue to map the substrate binding pocket preferences.

How does ppiD interact with other components of the bacterial protein folding machinery?

Peptidyl-prolyl cis-trans isomerase D functions as an integral component of the periplasmic protein quality control network in Haemophilus influenzae and related bacteria. Based on studies in related organisms, ppiD likely participates in multiprotein complexes with other folding factors:

• Interaction with Sec translocon: ppiD likely associates with SecYEG components to facilitate folding of newly translocated proteins as they enter the periplasm.

• Cooperation with SurA: ppiD functions in parallel or cooperatively with SurA (another periplasmic PPIase) in outer membrane protein biogenesis.

• Compensatory relationship with chaperones: In stress conditions, ppiD may have functional overlap with Skp and DegP in preventing protein aggregation.

These interactions create a network that ensures proper protein folding and membrane protein insertion. Experimentally, these interactions can be studied using co-immunoprecipitation, bacterial two-hybrid assays, or proximity labeling methods such as APEX2 fusion proteins. Genetic approaches, including synthetic lethality screens with other chaperone mutants, can also reveal functional relationships within this network.

What experimental approaches can identify novel substrates of ppiD in vivo?

Identifying physiological substrates of ppiD requires integrative approaches that combine proteomics, genetics, and biochemical validation:

After identifying candidate substrates, validation should include in vitro folding assays comparing folding kinetics in the presence and absence of purified ppiD. Target verification can be strengthened by demonstrating proline-dependent effects, where mutagenesis of specific proline residues eliminates the dependency on ppiD for proper folding. Researchers should focus on periplasmic and outer membrane proteins as these represent the most likely physiological substrates of ppiD.

What are the implications of ppiD function for antibiotic resistance development in H. influenzae?

The potential role of ppiD in antibiotic resistance development in Haemophilus influenzae represents an emerging research area with significant clinical implications. As a periplasmic folding catalyst, ppiD may influence several resistance mechanisms:

• Outer membrane protein assembly: ppiD likely assists in the proper folding and insertion of porins and efflux pumps that control antibiotic entry and exit.

• Stress response modulation: By ensuring proper folding of stress response proteins, ppiD may contribute to adaptive responses under antibiotic pressure.

• Biofilm formation: Proper assembly of cell envelope components involved in biofilm formation, which is associated with increased antibiotic tolerance, may depend on ppiD activity.

Experimental approaches to investigate these connections include:

• Generating ppiD knockdown or overexpression strains and evaluating changes in minimum inhibitory concentrations (MICs) for various antibiotic classes

• Assessing the impact of ppiD mutations on membrane permeability using fluorescent dye uptake assays

• Examining changes in expression of ppiD and other folding factors following antibiotic exposure

• Evaluating biofilm formation capacity in ppiD mutant strains

Preliminary studies in related organisms suggest that alterations in periplasmic chaperone networks can contribute to antibiotic resistance phenotypes, highlighting the importance of further research on ppiD's role in this process.

How should researchers design site-directed mutagenesis experiments to probe ppiD catalytic mechanisms?

Designing effective site-directed mutagenesis experiments for ppiD requires careful selection of target residues based on sequence conservation and predicted functional roles:

Critical residues for mutagenesis strategy:

For a comprehensive analysis, researchers should create both alanine-scanning mutations (to assess residue importance) and more specific substitutions based on chemical properties. When targeting the catalytic mechanism, focus on creating mutations that:

• Disrupt the hydrophobic pocket accommodating the proline residue

• Alter hydrogen bonding networks that stabilize the transition state

• Modify residues involved in substrate recognition

Validation should include both activity measurements and structural analysis (CD spectroscopy at minimum) to ensure that activity changes are not simply due to protein misfolding. Combining mutagenesis with molecular dynamics simulations can provide additional mechanistic insights.

What considerations are important when designing inhibitor screens for ppiD?

Designing effective inhibitor screens for ppiD requires addressing several unique challenges related to this specific PPIase class:

• Assay selection and optimization:

  • Primary screens should utilize the chymotrypsin-coupled assay in a 96-well format

  • Counterscreens must include direct measurement of chymotrypsin inhibition to eliminate false positives

  • Fluorescence polarization-based assays using labeled peptide substrates provide alternatives for compounds with inherent absorbance

• Compound library considerations:

  • Focus on scaffolds distinct from traditional cyclophilin inhibitors (cyclosporin derivatives)

  • Include peptidomimetics targeting the proline-binding pocket

  • Consider fragment-based approaches for novel chemotypes

• Screening cascade design:

• Special considerations for transmembrane ppiD:

  • Ensure detergent compatibility with screening assays

  • Consider including membrane-mimetic environments (nanodiscs/liposomes)

  • Evaluate compound accessibility to the catalytic domain in the context of membrane insertion

Researchers should recognize that effective inhibitors might target either the catalytic activity or protein-protein interactions essential for physiological function.

How can crystallization conditions be optimized for structural studies of ppiD?

Crystallization of transmembrane proteins like ppiD presents significant challenges requiring methodical optimization:

• Protein preparation considerations:

  • Remove flexible regions identified by limited proteolysis

  • Consider separate crystallization of individual domains

  • Ensure monodispersity via SEC-MALS analysis prior to crystallization trials

  • Maintain strict temperature control during purification (4°C)

• Detergent screening strategy:

• Crystallization approach optimization:

  • Initial screening using commercial membrane protein screens (MemGold, MemSys)

  • Lipid cubic phase (LCP) crystallization as alternative to vapor diffusion

  • Addition of lipids (1-2% w/v) to stabilize native conformation

  • Co-crystallization with Fab fragments or nanobodies to increase polar surface area

• Advanced techniques:

  • Utilize surface entropy reduction mutations to promote crystal contacts

  • Screen temperature range (4-20°C) systematically

  • Consider microseeding from initial crystal hits

  • Explore crystallization chaperones (MBP fusion, T4 lysozyme insertion)

Despite these strategies, researchers should be prepared for significant optimization efforts, as membrane protein crystallization typically requires testing thousands of conditions. Alternative structural biology approaches such as cryo-EM should be considered in parallel, particularly for full-length ppiD.

What are the optimal storage conditions to maintain ppiD stability and activity?

Maintaining the stability and activity of purified recombinant ppiD requires careful attention to storage conditions, with different recommendations based on intended use and timeframe:

The optimal storage buffer composition includes:

• 20 mM Tris-HCl or phosphate buffer, pH 7.5

• 150 mM NaCl

• 0.05% suitable detergent (DDM or LMNG for full-length protein)

• 1 mM DTT or 5 mM β-mercaptoethanol (to prevent oxidation)

• 10% glycerol minimum (20% for freezing)

Researchers should avoid repeated freeze-thaw cycles, as indicated in the product notes. Each cycle can result in 10-15% activity loss. Working aliquots should be maintained at 4°C for up to one week, while the bulk protein should remain at -20°C or -80°C depending on intended storage duration.

How can researchers assess the quality of stored ppiD samples before experimental use?

Before using stored ppiD samples in experiments, researchers should employ a multi-parameter quality assessment approach:

• Activity assessment:

  • Perform standard PPIase activity assay using model substrates

  • Compare specific activity to freshly purified reference standards

  • Minimum acceptable activity threshold: >70% of reference

• Physical characterization:

• Visual inspection:

  • Check for visible aggregates or turbidity

  • Assess solution clarity after centrifugation (16,000×g, 10 min)

  • Verify protein concentration using absorbance at 280 nm

• Functional validation:

  • If possible, perform a small-scale application test

  • For binding studies, verify interaction with a well-characterized binding partner

  • For enzymatic studies, confirm linearity of reaction progress curves

Samples failing any of these quality assessments should be discarded or subjected to additional purification steps before experimental use. For critical experiments, preparing fresh protein is recommended despite the additional time investment.

What troubleshooting strategies address common issues with ppiD stability?

When encountering stability issues with recombinant ppiD, researchers can implement the following systematic troubleshooting approaches:

• Addressing precipitation during storage:

• Activity loss without visible aggregation:

  • Verify detergent concentration is above CMC but below levels that interfere with activity

  • Add stabilizing lipids (0.1-0.5 mg/mL) that mimic native membrane environment

  • Test alternative detergents or mixed micelle systems

  • Consider detergent exchange to more stable alternatives like GDN or LMNG

• Surface adsorption issues:

  • Use low-binding microcentrifuge tubes for storage

  • Include 0.05-0.1% BSA as a carrier protein in very dilute solutions

  • Pre-coat storage containers with detergent solution

• Proteolytic degradation:

  • Add protease inhibitor cocktail to storage buffer

  • Verify purity by SDS-PAGE before and after storage

  • Consider adding EDTA (1 mM) to chelate metal ions that may activate proteases

For cases of severe stability issues, researchers should consider alternative formulations such as reconstitution into nanodiscs or liposomes, which often provide superior stability for membrane proteins compared to detergent micelles.

How can ppiD be utilized as a model system for studying membrane protein folding mechanisms?

Recombinant Haemophilus influenzae ppiD presents a valuable model system for investigating fundamental aspects of membrane protein folding through several experimental approaches:

• Domain contribution analysis:

  • Express individual domains and chimeric constructs

  • Measure folding rates and stability of each domain independently

  • Determine cooperative folding relationships between domains

• Real-time folding studies:

• Membrane integration studies:

  • Reconstitution systems using liposomes of defined composition

  • Cell-free translation systems with supplied membranes

  • Quantification of topology and insertion efficiency

• Folding catalyst self-sufficiency:

  • Investigate whether ppiD can catalyze its own folding (autocatalysis)

  • Compare folding kinetics in the presence of active vs. inactive ppiD

These approaches can address fundamental questions about membrane protein biogenesis, including how transmembrane segments integrate into lipid bilayers, how soluble domains fold in proximity to membranes, and how folding catalysts themselves achieve their native conformation.

What potential exists for developing ppiD-based therapeutics targeting H. influenzae infections?

The exploration of ppiD as a target for novel therapeutics against Haemophilus influenzae infections represents an emerging research direction with several promising aspects:

• Target validation considerations:

  • Assess essentiality under infection-relevant conditions

  • Determine virulence attenuation in ppiD-deficient strains

  • Evaluate conservation across clinical isolates to predict resistance development

• Therapeutic approaches:

• Combination therapy potential:

  • Inhibition of ppiD may sensitize H. influenzae to existing antibiotics by compromising envelope integrity

  • Synergistic effects with β-lactams or membrane-active antimicrobials should be evaluated

• Translational research directions:

  • Perform high-throughput screening of compound libraries against purified ppiD

  • Develop cell-based assays measuring ppiD inhibition within intact bacteria

  • Establish animal models to evaluate efficacy of ppiD-targeting approaches

The development of ppiD-targeted therapeutics would benefit from partnerships between academic researchers and pharmaceutical companies with expertise in anti-infective development pipelines. Future research should include systematic structure-activity relationship studies of promising inhibitor scaffolds.

How might CRISPR-Cas9 genome editing be applied to study ppiD function in Haemophilus influenzae?

CRISPR-Cas9 technology offers powerful approaches for investigating ppiD function in Haemophilus influenzae through precise genetic manipulation:

• Gene knockout and complementation strategies:

  • Generate clean deletions without polar effects on adjacent genes

  • Perform domain-specific deletions to map functional regions

  • Create complementation strains with controlled expression levels

• Site-directed genome editing:

• CRISPRi applications:

  • Establish inducible knockdown systems for essential genes

  • Create expression gradients to determine threshold levels

  • Perform temporal control of expression during infection models

• High-throughput genetic screens:

  • Generate sgRNA libraries targeting potential genetic interactors

  • Identify synthetic lethal or synthetic sick interactions

  • Map genetic networks connected to ppiD function

Practical implementation requires optimization of transformation protocols for Haemophilus influenzae, which has lower transformation efficiency than model organisms. Researchers should consider using a two-plasmid system: one carrying the Cas9 under an inducible promoter and another containing the sgRNA and homology-directed repair template. Validation of genome edits should include whole-genome sequencing to identify potential off-target effects.