Recombinant Haemophilus influenzae Phosphatidate cytidylyltransferase (cdsA)

Shipped with Ice Packs
In Stock

Description

Role in Antibiotic Resistance and Membrane Remodeling

CdsA-mediated phospholipid alterations are central to antibiotic resistance. In S. mitis/oralis, DAP-resistant mutants exhibit:

  • Complete loss of PG and CL.

  • Accumulation of phosphatidate (PA), the substrate for CdsA.

  • DAP hyperaccumulation in a subpopulation, suggesting heterogeneous resistance mechanisms .

PhenotypeWild-TypeDAP-Resistant Mutant
Phosphatidylglycerol (PG)PresentUndetectable
Cardiolipin (CL)PresentUndetectable
Phosphatidate (PA)Low levelsElevated

Genetic and Functional Implications

While direct studies on H. influenzae CdsA are absent in the provided sources, insights from analogous systems highlight its potential significance:

  • Membrane Remodeling: Loss of PG/CL alters membrane charge and fluidity, which may evade host immune responses or antibiotic targeting.

  • Cross-Resistance to Antimicrobial Peptides: Anionic phospholipid depletion (e.g., PG) reduces susceptibility to cationic antimicrobial peptides like human neutrophil peptides (hNP-1) .

Research Gaps and Future Directions

  • Structural Characterization: High-resolution crystallography to map H. influenzae CdsA’s active site.

  • Pathogenesis Links: Role of CdsA in biofilm formation, intracellular invasion, or evasion of complement-mediated killing (e.g., via Factor H binding) .

Recombinant Production and Applications

Recombinant CdsA is typically expressed in heterologous systems (e.g., E. coli) for biochemical studies. Key considerations include:

  • Purification: Affinity chromatography followed by size-exclusion chromatography to ensure homogeneity.

  • Enzymatic Assays: Quantification of CDP-DAG production using thin-layer chromatography (TLC) or mass spectrometry .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cdsA; cds; HI_0919; Phosphatidate cytidylyltransferase; CDP-DAG synthase; CDP-DG synthase; CDP-diacylglycerol synthase; CDS; CDP-diglyceride pyrophosphorylase; CDP-diglyceride synthase; CTP:phosphatidate cytidylyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-288
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
cdsA
Target Protein Sequence
MLKQRVLSAIVLIAAVLCALFLFTPFYFALALGAVAILGIWEWTQFARLKQPLIRFFVTT FLGVFIFLWLYTEGNYLDAGRVFEQHLQLLLINAVSWWGLALLLVISYPKSAKFWSKNPL LQLLFAFSTLIPFVAGVLRLRLEHYTHDPYHGLFLLLYVFILVWAADSGAYFSGRAFGKR KLAPKVSPGKSWEGVIGGLITALVLAFIFIHFSNNTLVGDRNITGFIILSVATVAISVLG DLTESMFKRESGVKDSSQLIPGHGGVLDRIDSLTAAVPFFSYFYFFVL
Uniprot No.

Target Background

Database Links

KEGG: hin:HI0919

STRING: 71421.HI0919

Protein Families
CDS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Phosphatidate cytidylyltransferase (cdsA) and what is its primary function?

Phosphatidate cytidylyltransferase (cdsA) is an essential enzyme (EC 2.7.7.41) that catalyzes the synthesis of cytidine diphosphate-diacylglycerol (CDP-DAG), a critical phospholipid intermediate in bacterial membranes. This intermediate serves as a precursor for the production of membrane phosphatidylglycerol and cardiolipin, which are fundamental components of bacterial cell membranes . The enzyme is also known by several alternative names including CDP-DAG synthase, CDP-DG synthase, CDP-diacylglycerol synthase (short name: CDS), CDP-diglyceride pyrophosphorylase, and CDP-diglyceride synthase . In Haemophilus influenzae, cdsA is encoded by the cdsA gene (also known as cds) with the ordered locus name HI_0919 .

The reaction catalyzed by cdsA can be summarized as:
Phosphatidate + CTP → CDP-diacylglycerol + pyrophosphate

This reaction represents a critical junction in phospholipid metabolism, directing the flux of phospholipid intermediates toward the synthesis of anionic phospholipids that contribute to membrane structure and function.

What is the structural composition of Haemophilus influenzae cdsA?

The recombinant Haemophilus influenzae cdsA protein (UniProt accession number P44937) consists of 288 amino acids in its full-length form . The amino acid sequence reveals a protein with multiple transmembrane domains, consistent with its function in membrane phospholipid biosynthesis. The protein contains hydrophobic regions that anchor it to the bacterial membrane, allowing it to interact with lipid substrates. The specific amino acid sequence includes characteristic motifs associated with nucleotide binding and transferase activity .

What are the recommended methods for expressing recombinant Haemophilus influenzae cdsA?

Recombinant Haemophilus influenzae cdsA is typically expressed in Escherichia coli expression systems using optimized conditions to maximize protein yield and solubility . For optimal expression, researchers should consider using multivariant analysis and statistical experimental design approaches rather than traditional univariant methods. These advanced techniques allow for the simultaneous evaluation of multiple variables that might affect protein expression, including temperature, induction time, media composition, and inducer concentration .

A statistical experimental design methodology enables researchers to:

  • Evaluate variables that are statistically significant for cdsA expression

  • Account for interactions between variables

  • Characterize experimental error

  • Compare the effects of different variables when they are normalized

  • Optimize culture conditions with fewer experiments and minimal resources

This approach is particularly valuable for membrane-associated proteins like cdsA that may present challenges in expression and solubility. By systematically testing combinations of variables according to factorial design principles, researchers can identify optimal conditions that maximize the yield of functional protein.

What are the optimal storage and handling conditions for recombinant cdsA preparations?

For optimal stability and activity of recombinant Haemophilus influenzae cdsA, storage conditions must be carefully controlled. The protein is typically available in either liquid or lyophilized forms, each with different stability profiles. The shelf life of liquid preparations is generally 6 months when stored at -20°C or -80°C, while lyophilized forms maintain stability for approximately 12 months at similar temperatures .

For reconstitution of lyophilized protein:

  • Briefly centrifuge the vial prior to opening

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is commonly recommended)

  • Prepare working aliquots to minimize freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

Repeated freezing and thawing should be avoided as this can lead to protein degradation and loss of enzymatic activity. For long-term storage, aliquoting the protein solution before freezing is recommended to minimize freeze-thaw cycles .

How does cdsA activity influence bacterial membrane composition and antimicrobial resistance?

Research has revealed that cdsA plays a critical role in determining bacterial membrane phospholipid composition, which directly impacts susceptibility to antimicrobial agents. Studies with Streptococcus mitis/oralis have demonstrated that mutations in cdsA can lead to profound alterations in membrane phospholipid content and organization, resulting in high-level resistance to daptomycin (DAP) and other cationic antimicrobial peptides .

The mechanism involves:

  • Loss-of-function mutations in cdsA

  • Disruption of CDP-diacylglycerol synthesis

  • Significant reduction or complete elimination of phosphatidylglycerol (PG) and cardiolipin (CL) from bacterial membranes

  • Accumulation of phosphatidic acid (PA), the substrate for cdsA

  • Disappearance of anionic phospholipid microdomains from the cell membrane

  • Development of cross-resistance to cationic antimicrobial peptides from human neutrophils (e.g., hNP-1)

This resistance mechanism is particularly notable because it results in selective hyperaccumulation of antimicrobial agents in a small subpopulation of bacteria, while the majority of the population shows no binding of these compounds . This unique distribution pattern suggests a sophisticated survival strategy that allows bacterial populations to persist despite antimicrobial challenge.

How can researchers analyze changes in phospholipid profiles related to cdsA activity?

Several analytical techniques are available for investigating phospholipid profile changes associated with cdsA activity:

  • Two-dimensional thin-layer chromatography (2D TLC) - This technique allows separation and visualization of different phospholipid species based on their physicochemical properties. It has been successfully used to demonstrate the disappearance of PG and CL in bacterial strains with cdsA mutations .

  • Electrospray ionization mass spectrometry - This method provides confirmatory evidence for changes in phospholipid content, offering precise identification of phospholipid species based on their molecular weights and fragmentation patterns .

  • Fluorescent probe staining with 10-N-nonyl acridine orange (NAO) - This approach enables visualization of anionic phospholipid microdomains in bacterial membranes. NAO preferentially binds to cardiolipin but can also interact with other anionic phospholipids like PG .

When analyzing phospholipid profiles, researchers should compare results from multiple analytical techniques to ensure comprehensive characterization of membrane composition changes. Control experiments with wild-type strains are essential for accurate interpretation of results from cdsA mutants or strains with altered cdsA expression.

What experimental approaches can be used to study the relationship between cdsA function and antimicrobial resistance?

To investigate the relationship between cdsA function and antimicrobial resistance, researchers can employ a multi-faceted experimental approach:

  • Generation of isogenic strain pairs:

    • Create paired strains that differ only in cdsA sequence or expression level

    • Develop DAP-susceptible and DAP-resistant strain pairs to compare phenotypic differences

  • Genetic manipulation techniques:

    • Site-directed mutagenesis to introduce specific mutations in cdsA

    • Gene knockout and complementation studies to confirm causal relationships

    • Controlled expression systems to modulate cdsA levels

  • Antimicrobial susceptibility testing:

    • Minimum inhibitory concentration (MIC) determination for DAP and other antimicrobials

    • Time-kill assays to assess killing kinetics

    • Cross-resistance profiles against various cationic antimicrobial peptides

  • Membrane composition analysis:

    • Phospholipid profiling using 2D TLC and mass spectrometry

    • Fluorescent microscopy with lipid-binding probes to visualize membrane domains

    • Quantitative analysis of phospholipid species before and after antimicrobial exposure

  • Antimicrobial binding studies:

    • Fluorescently labeled antimicrobial agents to track cellular distribution

    • Flow cytometry to analyze population heterogeneity in antimicrobial binding

    • Quantification of antimicrobial agent accumulation in different bacterial subpopulations

These approaches, used in combination, provide comprehensive insights into how cdsA-mediated alterations in phospholipid metabolism influence antimicrobial resistance mechanisms.

How can multivariant statistical approaches improve experimental design in cdsA research?

Multivariant statistical approaches offer significant advantages for optimizing experimental conditions in cdsA research:

  • Factorial design benefits:

    • Enables evaluation of multiple variables simultaneously

    • Accounts for interactions between variables that might be missed in univariant approaches

    • Reduces the number of experiments needed to identify optimal conditions

    • Allows statistical characterization of experimental error

    • Permits comparison of normalized variable effects

  • Implementation strategy:

    • Identify critical variables that might affect the experimental outcome

    • Design a fractional factorial experiment that maintains orthogonality

    • Analyze results using statistical software to identify significant effects

    • Build mathematical models to predict optimal conditions

    • Validate predictions with confirmatory experiments

  • Application to cdsA expression optimization:

    • Systematically test combinations of temperature, media composition, induction time, and inducer concentration

    • Analyze protein yield and solubility as response variables

    • Identify conditions that maximize production of functional cdsA protein

This statistical approach is particularly valuable for membrane proteins like cdsA that may present expression challenges due to their hydrophobic nature and potential toxicity to host cells.

What are common challenges in working with recombinant cdsA and how can they be addressed?

Working with recombinant cdsA presents several technical challenges that researchers should anticipate and address:

  • Expression challenges:

    • Low expression levels due to toxicity to host cells

    • Formation of inclusion bodies due to improper folding

    • Poor solubility due to hydrophobic transmembrane domains

    Solutions:

    • Use lower induction temperatures (16-25°C) to slow protein synthesis and improve folding

    • Test different E. coli host strains optimized for membrane protein expression

    • Consider fusion tags that enhance solubility (e.g., MBP, SUMO)

    • Apply statistical experimental design to systematically optimize expression conditions

  • Purification difficulties:

    • Detergent selection for membrane protein extraction

    • Maintaining protein stability during purification

    • Achieving high purity while preserving activity

    Solutions:

    • Screen multiple detergents for optimal extraction efficiency

    • Include stabilizing agents (glycerol, specific lipids) in purification buffers

    • Use affinity chromatography followed by size exclusion chromatography

    • Validate protein purity by SDS-PAGE (target >85% purity)

  • Activity assessment:

    • Developing reliable assays for enzymatic activity

    • Distinguishing between inactive and active protein conformations

    • Correlating in vitro activity with physiological function

    Solutions:

    • Measure CDP-diacylglycerol formation using radioactive or fluorescent substrates

    • Compare activity of wild-type and mutant proteins to establish baseline

    • Complement gene knockout strains to confirm functional activity

Careful optimization of each experimental step, combined with appropriate quality control measures, will enhance the likelihood of successful work with recombinant cdsA.

What are emerging research questions regarding cdsA and phospholipid metabolism in bacteria?

Several promising research directions are emerging in the field of bacterial phospholipid metabolism and cdsA function:

  • Structure-function relationships:

    • Determining the three-dimensional structure of cdsA using X-ray crystallography or cryo-electron microscopy

    • Identifying critical residues for substrate binding and catalysis

    • Understanding how mutations alter enzyme activity and substrate specificity

  • Systems biology approaches:

    • Mapping the phospholipid metabolic network in different bacterial species

    • Identifying regulatory mechanisms that control cdsA expression and activity

    • Developing computational models to predict phospholipid flux under different conditions

  • Antimicrobial resistance mechanisms:

    • Elucidating the molecular basis of cdsA-mediated resistance to multiple antimicrobial agents

    • Investigating population heterogeneity in resistance mechanisms

    • Developing strategies to overcome resistance by targeting alternative pathways

  • Potential therapeutic applications:

    • Exploring cdsA as a target for novel antimicrobial development

    • Designing inhibitors that specifically target bacterial cdsA

    • Investigating combination therapies that target phospholipid metabolism

These research directions represent exciting opportunities for advancing our understanding of bacterial membrane biology and developing new approaches to combat antimicrobial resistance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.