Recombinant Haemophilus influenzae Preprotein translocase subunit SecE (secE)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Haemophilus influenzae Preprotein Translocase Subunit SecE (SecE) is a bacterial protein engineered for research purposes. It belongs to the Sec protein family, which facilitates the translocation of nascent polypeptides across the inner membrane in Gram-negative bacteria like H. influenzae. The recombinant version is produced in Escherichia coli and includes an N-terminal His-tag for purification and detection .

Key Properties of Recombinant SecE

PropertyDetails
Gene NamesecE (UniProt ID: P0AG98)
SourceE. coli (recombinant expression)
TagN-terminal His-tag
Protein LengthFull-length (1–127 amino acids)
FormLyophilized powder
Purity≥90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer (pH 8.0) with 6% trehalose
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL), with optional 5–50% glycerol

Genomic Context and Evolutionary Insights

SecE is part of the H. influenzae genome and has been identified in regions with high recombination density. For example, in H. influenzae serotype f isolates, SecE is located in genomic regions prone to horizontal gene transfer, suggesting potential roles in strain adaptation . These regions also encode other virulence factors, such as ATP-dependent proteases and toxin-antitoxin systems, highlighting SecE’s genomic proximity to genes involved in pathogenicity .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
secE; HI_0716; Protein translocase subunit SecE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-106
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
secE
Target Protein Sequence
MIFFAAAAIGNIYFQQIYSLPIRVIGMAIALVIAFILAAITNQGTKARAFFNDSRTEARK VVWPTRAEARQTTLIVIGVTMIASLFFWAVDSIIVTVINFLTDLRF
Uniprot No.

Target Background

Function
Essential subunit of the Sec protein translocation channel SecYEG. Clamps together the 2 halves of SecY. May contact the channel plug during translocation.
Database Links

KEGG: hin:HI0716

STRING: 71421.HI0716

Protein Families
SecE/SEC61-gamma family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Haemophilus influenzae and why is it a significant research organism?

Haemophilus influenzae is a gram-negative bacteria commonly found in the nose and throat of children and adults. Some individuals carry the bacteria without becoming ill, while others develop various infections. H. influenzae can cause several serious illnesses including meningitis (inflammation of the coverings of the spinal column and brain), bacteremia (blood infection), pneumonia (lung infection), and septic arthritis (joint infection) . The bacterium exists in several serotypes, with serotype B (Hib) historically being the most common cause of severe bacterial infection in children. Due to widespread Hib vaccination, reported cases have significantly decreased . As a well-studied pathogen with a relatively small genome that undergoes natural competence (the ability to take up and recombine DNA), H. influenzae represents an excellent model organism for studying bacterial genetic recombination and pathogenicity mechanisms .

What is the preprotein translocase subunit SecE and what is its role in H. influenzae?

The preprotein translocase subunit SecE is a component of the bacterial Sec protein translocation system, which is responsible for transporting proteins across the cytoplasmic membrane. In H. influenzae, the SecE protein functions as part of the essential SecYEG translocon complex that forms a channel in the bacterial membrane. This complex is vital for protein secretion and membrane protein insertion. Research has identified the secE gene as being located within regions of potential recombination in H. influenzae genomes, suggesting it may contribute to genetic diversity and potentially pathogenicity in different strains . Studying recombinant SecE provides insights into bacterial protein transport mechanisms and may reveal targets for antimicrobial interventions.

What genomic characteristics of the secE gene have been observed in H. influenzae?

The secE gene has been identified within a 7.8 kb region that contains a high density of genetic variants in H. influenzae, consistent with recombination events. This region contains approximately 260 variants, representing a significant portion (79.3%) of all variants detected in comparative genomic analyses . The secE gene is found alongside other important genes including ATP-dependent protease ATP-binding subunit ClpX, ATP-dependent Clp protease proteolytic subunit, trigger factor, TonB-dependent receptor, and RelE/StbE family type II toxin-antitoxin system mRNA interferase toxin. These genomic regions align with 94-97% nucleotide identity to H. influenzae strains from the Czech Republic (CGSHiCZ412602) and United Kingdom (NCTC8143) . This clustering of genetic variability suggests that secE may be subject to selection pressures related to bacterial fitness or virulence.

How does genetic recombination affect SecE structure and function in different H. influenzae strains?

Genetic recombination in H. influenzae has been demonstrated to generate significant diversity, with studies showing 3-6 recombination events per transformation of approximately 4-12 kb in length . The secE gene falls within one of these regions of high recombination, suggesting that genetic exchange may drive structural and functional variations in the SecE protein. Researchers investigating SecE should consider comparative analyses of protein structure and function across multiple H. influenzae isolates to determine how recombination events alter SecE's role in protein translocation. Molecular dynamics simulations coupled with experimental validation using site-directed mutagenesis can help identify critical domains affected by recombination. This approach requires sophisticated bioinformatic analysis to track amino acid changes across the phylogenetic spectrum of H. influenzae strains, followed by functional assays to measure protein transport efficiency.

What are the methodological challenges in expressing and purifying recombinant H. influenzae SecE for structural studies?

Expressing and purifying membrane proteins like SecE presents significant challenges for structural biology research. Membrane proteins often exhibit toxicity when overexpressed, form inclusion bodies, or fail to fold properly in heterologous expression systems. When working with H. influenzae SecE, researchers should consider several approaches: (1) Testing multiple expression systems including specialized E. coli strains designed for membrane protein expression; (2) Utilizing fusion tags that enhance solubility (such as maltose-binding protein or thioredoxin); (3) Optimizing detergent screening for extraction and purification; and (4) Implementing nanodiscs or other membrane mimetics for stabilization. The experimental design should include controls to verify protein folding and functionality, such as circular dichroism spectroscopy and activity assays measuring protein translocation. Researchers must balance protein yield with maintaining native conformation to ensure structural studies yield physiologically relevant information.

How can Transformed Recombinant Enrichment Profiling (TREP) be applied to study SecE function in H. influenzae?

TREP represents an innovative approach for investigating genetic determinants of bacterial phenotypes by utilizing natural transformation to generate complex recombinant pools, followed by phenotypic selection and deep sequencing . To apply TREP specifically to study SecE function, researchers could:

  • Generate a donor DNA library from H. influenzae strains with varying SecE sequences

  • Transform this DNA into recipient strains with tagged or otherwise modified SecE

  • Apply selective pressure that depends on SecE functionality (e.g., growth under conditions requiring efficient protein secretion)

  • Use deep sequencing to identify enriched SecE variants

This approach would reveal which SecE variants confer advantages under specific environmental conditions, potentially identifying functional domains critical for protein translocation efficiency. The experimental design must include appropriate controls to account for background recombination events and should be coupled with complementary functional assays to validate the phenotypic effects of observed genetic variations .

What are the optimal protocols for cloning and expressing recombinant H. influenzae SecE?

To successfully clone and express recombinant H. influenzae SecE, researchers should implement a methodical approach:

  • Gene synthesis optimization: Since H. influenzae has different codon usage than common expression hosts, codon optimization should be performed for the expression system of choice.

  • Vector selection: For a membrane protein like SecE, vectors with tightly regulated promoters (e.g., pET with T7lac promoter) help control expression levels to prevent toxicity.

  • Expression host selection: Specialized E. coli strains such as C41(DE3) or C43(DE3), designed for membrane protein expression, often yield better results than standard BL21(DE3).

  • Induction parameters:

    ParameterRecommended RangeNotes
    IPTG concentration0.1-0.5 mMLower concentrations often better for membrane proteins
    Temperature16-30°CLower temperatures slow expression and improve folding
    Duration4-16 hoursLonger times at lower temperatures typically optimal
    MediaTerrific Broth or 2xYTRich media improves yield
  • Fusion tag strategy: N-terminal fusion tags (His6, MBP, or SUMO) with precision protease cleavage sites facilitate purification while enabling tag removal.

  • Extraction optimization: Testing multiple detergents (DDM, LDAO, OG) at various concentrations is essential for efficient solubilization without denaturation.

The success of expression should be verified by Western blotting, and functionality assessed through complementation assays in SecE-depleted strains or in vitro translocation assays.

How can researchers design reliable assays to measure SecE functionality in protein translocation?

Assessing SecE functionality requires robust assays that specifically measure protein translocation efficiency. Researchers should consider implementing:

  • In vivo reporter system: Construct fusion proteins consisting of a signal sequence followed by a reporter (e.g., alkaline phosphatase or β-lactamase) whose activity depends on successful translocation. Quantitative comparisons of reporter activity between wild-type and mutant SecE variants provide functional insights.

  • Membrane fractionation analysis: Separate cytoplasmic, membrane, and periplasmic fractions to track the distribution of model secretory proteins in strains expressing different SecE variants.

  • Reconstituted proteoliposome assays: Purify SecYEG complexes containing various SecE variants and reconstitute them into liposomes. Measure ATP-dependent translocation of fluorescently labeled preproteins in vitro.

  • Site-specific crosslinking: Introduce photo-activatable crosslinkers at specific positions in SecE to capture transient interactions with translocation substrates or other translocon components.

  • FRET-based interaction assays: Engineer fluorescent protein pairs into SecE and other Sec components to monitor complex assembly and dynamics during translocation.

These assays should be validated using positive controls (known functional SecE variants) and negative controls (SecE variants with mutations in essential residues). Statistical analysis should include multiple biological replicates (n≥3) and appropriate tests for significance.

What are the best approaches for analyzing sequence variations in secE across clinical H. influenzae isolates?

To comprehensively analyze secE sequence variations across clinical isolates, researchers should implement an integrated bioinformatic and experimental approach:

  • Sample collection and sequencing:

    • Collect diverse H. influenzae isolates from various anatomical sites, patient demographics, and geographical locations

    • Perform whole-genome sequencing using platforms that provide high accuracy (e.g., Illumina)

    • Ensure sufficient coverage (>30x) for reliable variant calling

  • Bioinformatic analysis pipeline:

    • Align sequences to reference genomes using tools like BWA or Bowtie2

    • Call variants with GATK, FreeBayes, or similar variant callers

    • Perform quality filtering to minimize false positives

    • Annotate variants for predicted effects on protein structure and function

  • Population genetic analysis:

    • Calculate nucleotide diversity (π) and Tajima's D to detect selection signatures

    • Perform phylogenetic analysis to identify clades with distinct secE variants

    • Use recombination detection methods (e.g., ClonalFrameML) to identify horizontally transferred segments

  • Structure-function correlation:

    • Map sequence variations onto predicted or experimentally determined structural models

    • Identify conservation patterns in functionally important domains

    • Classify variants based on predicted impact on protein function

  • Experimental validation:

    • Select representative secE variants for functional characterization

    • Perform complementation studies in secE-depleted backgrounds

    • Measure protein translocation efficiency for each variant

This comprehensive approach enables researchers to connect sequence diversity with functional implications and potential evolutionary advantages conferred by specific secE variants.

How should researchers analyze discrepancies between predicted and observed SecE functions in recombinant systems?

When researchers encounter discrepancies between predicted and observed SecE functions in recombinant systems, a systematic troubleshooting approach is essential:

  • Expression system evaluation: Verify that SecE is correctly expressed and properly localized to the membrane using fractionation studies and immunoblotting.

  • Protein-protein interaction assessment: Since SecE functions as part of the SecYEG complex, discrepancies may result from improper interactions with SecY or SecG. Use co-immunoprecipitation or bacterial two-hybrid assays to verify complex formation.

  • Post-translational modification analysis: Check for potential missing post-translational modifications in heterologous systems using mass spectrometry.

  • Statistical analysis framework: When comparing multiple SecE variants, implement appropriate statistical methods as outlined in the table below:

    Analysis ScenarioRecommended Statistical MethodInterpretation Considerations
    Comparing multiple groupsOne-way ANOVA with post-hoc testsCorrect for multiple comparisons using Tukey or Bonferroni
    Time-course experimentsRepeated measures ANOVAAccount for within-subject correlation
    Correlation studiesPearson or Spearman correlationConsider nonlinear relationships
    High-throughput screensFalse discovery rate controlUse Benjamini-Hochberg procedure
  • Host compatibility factors: Consider whether H. influenzae-specific factors absent in the recombinant system might be required for proper SecE function .

  • Control for batch effects: Implement randomization in experimental design and include appropriate controls in each experimental batch to minimize systematic errors .

What bioinformatic approaches are most effective for predicting functional impacts of SecE variations identified through TREP?

When analyzing SecE variations identified through TREP experiments, researchers should implement a multi-layered bioinformatic approach:

  • Conservation analysis: Calculate positional conservation scores across diverse bacterial species using tools like ConSurf or Rate4Site. Mutations at highly conserved positions are more likely to impact function.

  • Structural impact prediction: Use tools like PROVEAN, SIFT, or PolyPhen-2 adapted for bacterial proteins to predict whether amino acid substitutions are tolerated. For more accurate predictions, map variations onto structural models using homology modeling platforms like I-TASSER or AlphaFold.

  • Molecular dynamics simulations: For critical variations, perform molecular dynamics simulations to predict changes in protein flexibility, stability, or interaction interfaces.

  • Protein-protein interaction networks: Since SecE functions within a complex, use tools like STRING or interolog mapping to predict how variations might affect interactions with other Sec components.

  • Evolutionary coupling analysis: Identify co-evolving residues using methods like direct coupling analysis (DCA) or statistical coupling analysis (SCA). Variations affecting these networks may have functional consequences even if they occur at non-conserved sites.

  • Integration of multiple predictors: Combine predictions from various tools using ensemble approaches or machine learning methods trained on bacterial membrane protein datasets for improved accuracy.

This comprehensive approach helps prioritize SecE variants for experimental validation and provides mechanistic hypotheses about how specific variations might alter protein translocation efficiency in H. influenzae.

How can researchers resolve contradictions in experimental results when studying SecE function across different H. influenzae strains?

Resolving contradictory results when studying SecE across different H. influenzae strains requires a systematic approach to identify sources of variation:

  • Genomic context analysis: Examine the genomic neighborhood of secE in each strain, as adjacent genes might influence SecE expression or function. The secE gene has been identified in a region containing multiple other genes including ATP-dependent proteases and toxin-antitoxin systems that could affect phenotypic outcomes .

  • Strain background effects: Create isogenic strains where the only difference is the secE variant by using precise gene replacement techniques. This eliminates confounding effects from other genetic differences.

  • Environmental condition standardization: Test for strain-specific responses to experimental conditions by performing assays across a range of temperatures, pH values, and nutrient conditions.

  • Protein expression level verification: Quantify SecE expression levels in each strain using quantitative Western blotting or targeted proteomics, as expression differences can mask functional variations.

  • Experimental design considerations: Implement factorial experimental designs to systematically test for interaction effects between strain background and experimental conditions .

  • Meta-analysis approach: When multiple studies produce contradictory results, perform a formal meta-analysis incorporating all available data while accounting for differences in experimental methods.

  • Preregistration of experimental protocols: To avoid bias in interpreting contradictory results, researchers should consider preregistering their experimental protocols and analysis plans before conducting confirmatory experiments .

By systematically addressing these potential sources of variation, researchers can determine whether contradictions reflect true biological differences in SecE function across strains or methodological inconsistencies that need to be resolved.

What are the most promising future research directions for understanding H. influenzae SecE recombination and its impact on pathogenicity?

Future research on H. influenzae SecE should focus on integrating evolutionary, structural, and functional approaches to understand how recombination in this gene influences bacterial fitness and pathogenicity. Promising research directions include:

  • Population genomics studies correlating secE variants with clinical outcomes to identify potential virulence-associated alleles.

  • CRISPR-based genome editing to introduce specific secE variants into isogenic backgrounds for direct comparison of phenotypic effects.

  • Cryo-EM structural studies of the SecYEG complex from different H. influenzae strains to visualize how sequence variations alter the translocation channel.

  • Identification of SecE-dependent secreted virulence factors through comparative secretome analysis of strains with different secE alleles.

  • Development of high-throughput screening methods to identify small molecule inhibitors that specifically target variant SecE proteins as potential strain-specific antimicrobials.

H. influenzae's natural competence and active recombination provide a unique opportunity to study how protein transport machinery evolves and adapts . By leveraging advanced genomic, proteomic, and structural biology techniques, researchers can develop a comprehensive understanding of how SecE variation contributes to bacterial pathogenesis and potentially identify novel therapeutic targets.

How can researchers standardize methods for studying recombinant H. influenzae SecE to ensure reproducibility across laboratories?

To enhance reproducibility in H. influenzae SecE research, standardizing methods across laboratories is essential:

  • Reference strain selection: Establish a panel of well-characterized H. influenzae reference strains with sequenced genomes representing major phylogenetic lineages.

  • Plasmid repository creation: Develop a centralized repository of validated expression constructs for various SecE variants with standardized fusion tags and expression systems.

  • Protocol standardization: Create detailed protocols for:

    • Gene amplification and cloning

    • Protein expression and purification

    • Functional assays with clearly defined positive and negative controls

    • Data analysis workflows including standardized statistical approaches

  • Reporting standards: Implement comprehensive reporting requirements including:

    • Detailed strain information including accession numbers

    • Expression conditions with exact parameters

    • Purification yields and purity assessments

    • Raw data availability in public repositories

  • Interlaboratory validation: Organize regular interlaboratory studies where multiple research groups perform identical experiments to identify and address sources of variability.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.