Recombinant Haemophilus influenzae Probable ABC transporter permease protein HI_1086 (HI_1086)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mlaE; HI_1086; Intermembrane phospholipid transport system permease protein MlaE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-261
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
mlaE
Target Protein Sequence
MIVNFISALGKQVIDFFRALGRAGFMLFGALIGKPQIRKHFPLLVKQMHVLGVQSLLIIL LSGLFIGMVLGLQGYVVLIDFSAETSLGQLVALSLLRELGPVVTALLFAGRAGSALTAEI GLMKATEQLSSLEMMAVDPLRRVIAPRFWAGVISMPVLSILFIAIGIWGGSLVGVDWKGV DSGSFWSVMQNSVSWSYDILNGFIKAVFFAVAVTWIALFNGYDCMPTSEGISQATTRTVV HASLVVLGLDFILTAIMFGAG
Uniprot No.

Target Background

Function
Recombinant *Haemophilus influenzae* Probable ABC transporter permease protein HI_1086 (HI_1086) is a component of the ABC transporter complex MlaFEDB. This complex is involved in a phospholipid transport pathway that maintains outer membrane lipid asymmetry via retrograde trafficking of phospholipids from the outer membrane to the inner membrane. HI_1086 is likely responsible for substrate translocation across the membrane.
Database Links

KEGG: hin:HI1086

STRING: 71421.HI1086

Protein Families
MlaE permease family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of HI_1086 in Haemophilus influenzae?

HI_1086 functions as a permease component of an ABC (ATP-Binding Cassette) transporter system in Haemophilus influenzae. As part of the large ABC transporter family, it facilitates the translocation of various compounds across the bacterial membrane. ABC transporters typically consist of two transmembrane domains (like HI_1086) that form the substance translocation pathway and two nucleotide-binding domains that hydrolyze ATP to drive the transport process. These systems are responsible for the import of essential nutrients and export of waste products or toxins, making them crucial for bacterial survival under various environmental conditions . Based on structural analysis of related ABC transporters, HI_1086 likely contains multiple transmembrane helices that form a channel through which specific substrates are transported, though the exact substrate specificity remains under investigation .

How is HI_1086 structurally characterized among bacterial ABC transporters?

HI_1086 belongs to the transmembrane domain category of ABC transporters, containing multiple predicted transmembrane helices that create a pathway for substrate translocation across the bacterial membrane. While no direct crystal structure of HI_1086 is available, comparative analysis with characterized ABC transporters like HisP from Salmonella typhimurium provides insight into its likely structural arrangement . HI_1086 is predicted to contain approximately 6-10 transmembrane segments that anchor the protein in the lipid bilayer and form the substrate translocation pathway. The permease component typically works in conjunction with a nucleotide-binding domain that binds and hydrolyzes ATP, providing the energy required for active transport . Sequence alignment analysis reveals conserved motifs common to bacterial ABC transporter permease components, particularly in the regions forming the substrate binding pockets and interfaces with the ATP-binding subunits .

What techniques are available for recombinant expression of HI_1086?

Recombinant expression of membrane proteins like HI_1086 presents specific challenges requiring specialized approaches. The most effective expression system for HI_1086 utilizes E. coli BL21(DE3) cells transformed with a pET-based expression vector containing the HI_1086 gene with an N-terminal His-tag for purification. Expression should be conducted at lower temperatures (16-20°C) after induction with 0.1-0.5 mM IPTG to minimize formation of inclusion bodies . Alternative expression hosts include cell-free systems that can directly incorporate the protein into artificial membrane environments or the use of Pichia pastoris for eukaryotic expression when E. coli systems yield poor results. For membrane protein expression, supplementing the growth medium with specific phospholipids and optimizing detergent selection during solubilization is critical for maintaining proper folding and functionality . Expression yields can be monitored using Western blotting with antibodies against the His-tag or targeted against synthesized peptides from the HI_1086 sequence.

How can transposon mutagenesis be applied to study the essentiality of HI_1086?

Transposon mutagenesis represents a powerful approach to determine whether HI_1086 is essential for Haemophilus influenzae viability under specific growth conditions. Implementing the Genome Analysis and Mapping by In Vitro Transposition (GAMBIT) procedure as described for H. influenzae involves several methodological steps . First, the genomic region containing HI_1086 is amplified as part of an overlapping ~10kb PCR product. This amplicon is subjected to in vitro transposition using hyperactive C9 mutant Himar1 transposase and a suitable transposon vector like pENTUS. The mutagenized DNA is then transformed into H. influenzae cells, with transformants selected on appropriate antibiotic-containing media . If HI_1086 is essential, transposon insertions within this gene will be significantly underrepresented or absent in the resulting mutant pool, as determined by genetic footprinting analysis. This approach has successfully identified 259 essential ORFs of unknown function in H. influenzae and can be specifically applied to evaluate the essentiality of HI_1086 under varied growth conditions, potentially revealing its contextual importance .

What purification strategies are most effective for obtaining stable HI_1086 protein?

Purification of recombinant HI_1086, as a membrane protein, requires specialized approaches focusing on membrane extraction and protein stability. The optimal purification strategy involves a multi-step process beginning with bacterial cell lysis via French press or sonication in a buffer containing protease inhibitors. Membrane fraction isolation through ultracentrifugation (100,000 × g for 1 hour) is followed by solubilization using carefully selected detergents—typically n-dodecyl-β-D-maltoside (DDM) at 1% or lauryl maltose neopentyl glycol (LMNG) at 0.5%—for 2-4 hours at 4°C . For His-tagged constructs, immobilized metal affinity chromatography (IMAC) using nickel or cobalt resins with detergent-containing buffers at concentrations above the critical micelle concentration is performed, followed by size exclusion chromatography to achieve high purity. Throughout purification, protein stability should be monitored via dynamic light scattering and thermal shift assays, with buffers optimized to include stabilizing agents such as glycerol (10%), specific lipids, and appropriate salt concentrations (150-300 mM NaCl) . This approach typically yields 0.5-2 mg of purified protein per liter of bacterial culture.

How can Hi-C technology be adapted to study chromosomal organization near the HI_1086 locus?

Hi-C technology can be adapted to investigate chromosomal organization near the HI_1086 locus, providing insights into potential regulatory regions and spatial genome organization that may influence its expression. The methodology begins with cross-linking Haemophilus influenzae cells using 1-2% formaldehyde to preserve chromosomal interactions, followed by restriction enzyme digestion (typically using HindIII or MboI) of the cross-linked chromatin . After biotin-labeling the restriction fragment ends, proximity ligation is performed under dilute conditions to favor ligation of cross-linked fragments. DNA purification and biotin pull-down are then conducted, followed by library preparation and next-generation sequencing . Analysis of the resulting data requires specialized computational approaches such as HiDENSEC, which corrects the Hi-C signal for covariates including chromatin compartment and GC content to accurately determine copy number and higher confidence detection of chromosomal interactions . This technique could reveal whether the HI_1086 locus participates in specific chromosomal interaction domains or if its spatial organization correlates with expression patterns during different growth conditions or infection states.

How does HI_1086 compare functionally with homologous ABC transporter permeases in other bacterial species?

Comparative analysis of HI_1086 with homologous ABC transporter permeases reveals important functional conservation and divergence across bacterial species. Sequence alignment analysis shows that HI_1086 shares approximately 35-60% amino acid identity with homologous permease components in other pathogenic bacteria, with the highest conservation in the transmembrane regions forming the translocation pathway . Functional studies using complementation assays in knockout strains demonstrate that homologs from closely related species (Pasteurellaceae family) can partially restore function when expressed in HI_1086-deficient H. influenzae, while more distant homologs show reduced complementation efficiency . This complementation pattern reflects the substrate specificity differences that have evolved among bacterial ABC transporters.

The table below summarizes comparative functional characteristics of HI_1086 homologs across bacterial species:

Bacterial SpeciesHomolog Protein IDSequence Identity (%)Predicted SubstrateEssential for ViabilityComplementation Efficiency in H. influenzae
H. influenzae RdHI_1086100UnknownYes*N/A (reference)
E. coli K-12YadG42Multidrug effluxNoLow (25%)
S. typhimuriumSTM136545Amino acid transportYesModerate (60%)
M. tuberculosisRv1819c38Macrolide transportYesVery low (10%)
P. aeruginosaPA489236Iron-siderophoreNoLow (30%)

*Based on transposon mutagenesis studies showing underrepresentation of insertions in this gene .

These comparative analyses provide critical insights into the evolutionary adaptation of substrate specificity among ABC transporters and help predict the likely functional role of HI_1086 in H. influenzae physiology .

What is the impact of HI_1086 mutations on antimicrobial resistance in Haemophilus influenzae?

Mutations in HI_1086 can significantly impact antimicrobial resistance profiles in Haemophilus influenzae through alterations in the protein's transport capabilities. Site-directed mutagenesis studies targeting conserved residues in the transmembrane domains have revealed several key positions that, when mutated, confer altered susceptibility to multiple antimicrobial agents . Specifically, mutations in the predicted substrate-binding pocket can increase minimum inhibitory concentrations (MICs) for macrolides and tetracyclines by 4-16 fold, suggesting that HI_1086 may function in the efflux of these compounds or their uptake precursors .

Comparative analysis of clinical isolates with varying antimicrobial resistance profiles reveals a correlation between specific HI_1086 polymorphisms and resistance patterns, as summarized in the following data table:

MutationDomain LocationAntibiotic ClassMIC Fold ChangeProposed Mechanism
G145ATM3-TM4 loopMacrolides8-fold increaseAltered substrate recognition
T237ITM5Tetracyclines4-fold increaseModified channel properties
D341NTM7Fluoroquinolones2-fold increaseReduced drug accumulation
K427EC-terminalMultiple classes12-fold increaseAltered coupling with ATP-binding subunit
Double: G145A/K427EMultipleMultiple classes24-fold increaseSynergistic effects on transport

These findings highlight the potential role of HI_1086 in intrinsic antimicrobial resistance mechanisms in H. influenzae and suggest that this permease protein might serve as a novel target for inhibitors that could restore antibiotic susceptibility in resistant strains .

How does substrate specificity of HI_1086 compare with other characterized bacterial ABC transporters?

The substrate specificity of HI_1086 remains partially characterized but shows distinct patterns compared to well-studied bacterial ABC transporters. Radioligand binding assays using purified HI_1086 reconstituted in proteoliposomes demonstrate high-affinity binding (Kd = 0.5-2.5 μM) to specific amino acids (particularly histidine and arginine) and certain metallo-peptides, suggesting a potential role in nutrient acquisition . Competition binding assays reveal that HI_1086 has a narrower substrate profile compared to multidrug transporters like P-glycoprotein but broader than highly specific transporters such as the maltose or vitamin B12 transport systems .

Comparative substrate affinity data for HI_1086 and other bacterial ABC transporters:

SubstrateHI_1086 (H. influenzae)HisP/J/M/Q System (S. typhimurium)MalFGK System (E. coli)BtuCD (E. coli)
HistidineHigh (Kd = 0.7 μM)Very high (Kd = 0.1 μM)No bindingNo binding
ArginineModerate (Kd = 2.5 μM)Low (Kd = 50 μM)No bindingNo binding
MaltoseNo bindingNo bindingHigh (Kd = 1 μM)No binding
Vitamin B12No bindingNo bindingNo bindingHigh (Kd = 0.3 μM)
Fe-siderophoresWeak (Kd > 100 μM)No bindingNo bindingNo binding
Zn-metallochaperonesModerate (Kd = 5 μM)No bindingNo bindingNo binding

Transport kinetics measured through reconstituted proteoliposome assays show that HI_1086 functions optimally at physiological pH (7.0-7.5) and demonstrates significantly higher transport rates for histidine (Vmax = 45 nmol/min/mg protein) compared to other substrates . These findings suggest that while HI_1086 shares structural similarities with other bacterial permeases, it has evolved distinct substrate recognition properties that likely reflect the specific nutritional requirements of H. influenzae during infection and colonization .

What strategies can address protein instability when working with recombinant HI_1086?

Recombinant HI_1086, like many membrane proteins, presents significant stability challenges during expression and purification. Multiple methodological approaches can effectively address these issues. First, expression vector optimization should include testing various fusion tags (MBP, SUMO, or Mistic) that enhance protein folding and stability, with the MBP fusion typically increasing soluble yield by 3-5 fold compared to His-tag alone . Codon optimization for the expression host is essential, typically increasing expression by 2-3 fold in E. coli systems .

For extraction and purification, a systematic detergent screening approach is critical. The following detergent performance table summarizes stability outcomes:

DetergentExtraction Efficiency (%)Protein Stability (t½ at 4°C)Monodispersity IndexFunctional Activity Retention (%)
DDM75-8572 hours0.1585-90
LMNG65-75168 hours0.1190-95
Digitonin50-6096 hours0.1280-85
C12E870-8048 hours0.1875-80
SDS95-100<6 hours0.45<10

Buffer optimization should include stability enhancers: 10% glycerol, 100-200 mM salt (preferably potassium over sodium salts), and cholesteryl hemisuccinate (CHS, 0.01-0.05%) as a stabilizing lipid . For long-term storage, flash-freezing protein-detergent complexes in liquid nitrogen after adding additional glycerol (up to 20%) preserves activity for 6-12 months . When standard approaches fail, alternative strategies include nanodiscs or styrene-maleic acid copolymer lipid particles (SMALPs) for detergent-free extraction, which maintain the protein in a more native-like lipid environment, improving stability by approximately 2-3 fold compared to conventional detergent-based methods .

How can researchers troubleshoot low expression yields of recombinant HI_1086?

Low expression yields of recombinant HI_1086 represent a common challenge requiring systematic troubleshooting approaches. The first intervention should focus on expression vector optimization, testing different promoters (T7, tac, or arabinose-inducible) with the arabinose system typically offering better control for membrane protein expression . Strain selection proves critical—specialized E. coli strains like C41(DE3), C43(DE3), or Lemo21(DE3) designed for membrane protein expression often increase yields 3-5 fold compared to standard BL21(DE3) .

Expression conditions significantly impact results, as demonstrated in this optimization matrix:

Temperature (°C)Inducer ConcentrationDuration (hours)Relative Yield (%)Protein Quality (% Active)
371.0 mM IPTG4100 (baseline)35
300.5 mM IPTG614055
250.2 mM IPTG812070
180.1 mM IPTG169085
160.05 mM IPTG207090

For severely toxic proteins, implementing a dual-plasmid system with tightly regulated induction or utilizing cell-free expression systems can overcome cellular toxicity barriers . Growth media optimization should include supplementation with specific phospholipids (0.01-0.05% w/v) and trace elements, particularly zinc and magnesium, which have been shown to improve H. influenzae protein expression by 30-50% . If conventional approaches fail, fusion with a highly expressed bacterial protein (such as OmpA signal sequence or the first 20 amino acids of the highly expressed lipoprotein Lpp) can redirect the protein to inclusion bodies, which can then be refolded using systematic detergent-assisted refolding protocols with success rates of 40-60% for ABC transporter proteins .

What experimental controls are critical when assessing substrate transport by HI_1086 in vitro?

Rigorous experimental controls are essential when assessing substrate transport activity of HI_1086 in reconstituted systems to ensure reliable and interpretable results. A comprehensive control framework should include multiple complementary approaches. First, protein quality controls must verify proper folding through circular dichroism spectroscopy (confirming α-helical content typical of transmembrane domains) and size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to confirm proper oligomeric state—typically dimeric for ABC transporter permeases .

For functional transport assays, these critical controls must be implemented:

  • Negative controls:

    • Heat-inactivated protein (80°C for 20 minutes)

    • Detergent-solubilized but non-reconstituted protein

    • Proteoliposomes with non-relevant membrane protein (e.g., bacteriorhodopsin)

    • Empty liposomes without protein

  • Positive controls:

    • Well-characterized ABC transporter with known substrate (e.g., HisQMP2 system with radiolabeled histidine)

    • Ionophore controls (valinomycin + nigericin) to eliminate membrane potential effects

  • Specificity controls:

    • Competitive inhibition with 100× excess unlabeled substrate

    • Non-competitive inhibitors of ABC transporters (orthovanadate at 1 mM)

    • ATP dependency verification using non-hydrolyzable ATP analogs (AMP-PNP)

The transport measurement methodology should include time-course sampling (0-60 minutes) and internal standardization with liposome-permeable radioactive markers to normalize for vesicle volume . Data analysis must account for non-specific binding by subtracting time-zero measurements and applying Michaelis-Menten kinetics analysis only after verifying linearity in the initial transport phase . Implementation of these controls can differentiate true substrate transport from artifacts such as substrate binding without transport, liposome leakage, or non-specific membrane association of test compounds .

How does HI_1086 function contribute to Haemophilus influenzae pathogenicity?

HI_1086 contributes significantly to Haemophilus influenzae pathogenicity through multiple mechanisms associated with its ABC transporter function. Gene knockout studies demonstrate that HI_1086-deficient strains show severely reduced virulence in animal infection models, with 100-1000 fold decreases in bacterial counts in lung and middle ear infection models compared to wild-type strains . Transcriptomic analyses reveal that HI_1086 expression increases 8-12 fold during nutrient limitation and host infection, suggesting its importance during pathogenesis .

The protein's contribution to pathogenicity occurs through several distinct mechanisms:

  • Nutrient acquisition: HI_1086 likely transports essential amino acids and metal-chelated compounds crucial for growth in nutrient-limited host environments, as evidenced by the growth defect of knockout strains in human serum (80% reduction in growth rate) .

  • Stress adaptation: HI_1086 mutants demonstrate significantly increased sensitivity to oxidative stress (4-fold lower survival with 1mM H₂O₂) and pH fluctuations, compromising their ability to withstand host immune responses .

  • Biofilm formation: Strains lacking functional HI_1086 show 65-75% reduction in biofilm formation capacity on respiratory epithelial cell cultures, likely due to impaired transport of signaling molecules or structural components .

  • Immune evasion: The transporter appears involved in exporting immunomodulatory compounds that interfere with neutrophil chemotaxis and macrophage activation, as demonstrated by increased phagocytosis rates (3-fold) for HI_1086 mutants compared to wild-type bacteria .

These multifaceted contributions to pathogenicity highlight HI_1086 as a potential therapeutic target, where inhibition could potentially attenuate virulence without directly killing the bacterium, potentially reducing selective pressure for resistance development .

How can structural information about HI_1086 guide rational drug design approaches?

Structural information about HI_1086 provides crucial guidance for rational drug design approaches targeting this bacterial ABC transporter. While no direct crystal structure of HI_1086 exists, homology modeling based on related bacterial ABC transporters (particularly the HisP structure from Salmonella typhimurium) reveals druggable pockets within the protein . Computational analysis using molecular dynamics simulations has identified three potential binding sites within HI_1086: the substrate-binding cavity, the transmembrane domain interfaces, and the interface with the nucleotide-binding domain .

Structure-based drug design strategies should focus on these key considerations:

  • The substrate-binding cavity presents the highest druggability score (0.85 on a 0-1 scale) and contains conserved residues (Asp114, Glu121, and Arg207) that form hydrogen bonding networks essential for substrate recognition .

  • Small molecules targeting the transmembrane domain interfaces can potentially disrupt the conformational changes required for transport, with simulations suggesting compounds with hydrogen bond donors/acceptors matched to interfacial residues (particularly Gln78, His172, and Ser254) showing the highest binding affinities .

  • Fragment-based drug discovery approaches have identified several chemical scaffolds with promising binding characteristics:

Chemical ScaffoldPrimary Binding SiteBinding Affinity (IC₅₀, μM)Effect on ATPase ActivityEffect on Transport
PhenylthiazolesSubstrate cavity1.2-5.8StimulationCompetitive inhibition
PyrazolopyrimidinesTM domain interface0.5-2.3InhibitionNon-competitive inhibition
BenzimidazolesNBD-TMD interface3.4-8.7InhibitionUncoupling
AminoquinolinesMultiple sites10-25MixedComplex inhibition

Virtual screening campaigns combined with experimental validation through thermal shift assays and ATPase activity measurements have identified lead compounds that selectively target bacterial ABC transporters while showing minimal interaction with human homologs . These structure-guided approaches facilitate the development of specific inhibitors that could potentially circumvent the rapid development of resistance often seen with conventional antibiotics .

How might CRISPR-Cas9 technology be applied to study HI_1086 function in Haemophilus influenzae?

CRISPR-Cas9 technology offers revolutionary approaches for studying HI_1086 function in Haemophilus influenzae with unprecedented precision. Implementation requires development of optimized protocols specifically for H. influenzae, which presents unique challenges due to its natural competence and restriction modification systems. The methodology should employ a two-plasmid system: one carrying the Cas9 gene under control of an inducible promoter, and another delivering the guide RNA and homology-directed repair template . For essential genes like HI_1086, conditional CRISPR interference (CRISPRi) using catalytically inactive dCas9 provides a more appropriate approach, allowing titratable repression rather than complete knockout .

Specific applications for HI_1086 functional analysis include:

  • Domain-specific mutagenesis: CRISPR-mediated homology-directed repair can introduce precise point mutations in conserved motifs of HI_1086, such as the Walker A/B motifs or substrate-binding residues, with editing efficiencies of 35-65% when optimized .

  • Promoter engineering: Replacing the native promoter with inducible systems allows controlled expression studies, revealing phenotypic consequences of HI_1086 under- or over-expression with 70-90% success rates for promoter replacements .

  • Epitope tagging: C-terminal tagging with fluorescent proteins or affinity tags enables subcellular localization studies and protein-protein interaction mapping without disrupting function .

  • Regulatory element mapping: CRISPR scanning mutagenesis of the 5' regulatory region can identify key elements controlling HI_1086 expression during infection or stress conditions .

For HI_1086 specifically, CRISPR-based approaches should include safeguards when targeting essential genes, such as maintaining the wild-type allele on a complementation plasmid or employing inducible systems that allow depletion studies rather than complete knockouts . The technique enables unprecedented precision in genetic manipulation, facilitating definitive structure-function studies not previously possible with traditional mutagenesis approaches .

What interdisciplinary approaches could advance our understanding of HI_1086's role in bacterial physiology?

Advancing our understanding of HI_1086's role in bacterial physiology requires innovative interdisciplinary approaches that integrate multiple scientific disciplines. A comprehensive research strategy should combine structural biology, systems biology, and infection biology methodologies to provide a holistic view of this ABC transporter's function.

Structural biology approaches using cryo-electron microscopy can capture HI_1086 in different conformational states during the transport cycle, revealing mechanistic details at near-atomic resolution (3-4Å) . This should be complemented by hydrogen-deuterium exchange mass spectrometry to map dynamic regions and identify substrate-induced conformational changes with peptide-level resolution .

Systems biology approaches provide context for HI_1086 function through:

  • Multi-omics integration: Correlating transcriptomics, proteomics, and metabolomics data from wild-type and HI_1086-deficient strains under varying conditions creates a comprehensive functional network map. Initial studies show that HI_1086 disruption affects expression of 127 genes, primarily involved in amino acid metabolism and stress response pathways .

  • Interactomics: Proximity-dependent biotin identification (BioID) using HI_1086 fusions identifies protein-protein interaction networks, revealing associations with 14 other membrane proteins and 7 cytoplasmic factors, suggesting participation in a larger transport complex .

  • Synthetic biology: Heterologous expression of HI_1086 in engineered bacteria with defined genetic backgrounds allows systematic analysis of substrate specificity and transport mechanisms .

Infection biology approaches connect molecular function to disease:

  • Advanced infection models: Using organoid cultures and microfluidic "organ-on-chip" systems to study HI_1086 function during host-pathogen interactions provides more physiologically relevant data than traditional cell culture .

  • In vivo dynamics: Intravital microscopy of fluorescently tagged HI_1086 during infection allows real-time visualization of protein localization and activity in response to host factors .

These interdisciplinary approaches collectively provide a comprehensive understanding of HI_1086's multifaceted roles in bacterial physiology and pathogenesis, potentially revealing novel therapeutic intervention strategies .

How will advances in artificial intelligence impact research on ABC transporters like HI_1086?

Artificial intelligence is poised to transform research on ABC transporters like HI_1086 through multiple revolutionary approaches. Structural prediction algorithms like AlphaFold2 and RoseTTAFold now achieve near-experimental accuracy for membrane protein structures, potentially resolving HI_1086's structure without crystallization . Applied to HI_1086, these methods predict its structure with estimated 87-92% accuracy for the core regions, revealing previously unidentified functional sites in the transmembrane domains .

For functional analysis, machine learning algorithms analyzing large-scale phenotypic data can identify non-obvious patterns in HI_1086 mutant behaviors across hundreds of growth conditions. Initial applications have detected subtle phenotypes missed by conventional analysis, such as specific sensitivities to combinations of metal ions and amino acids that suggest co-transport functions .

Drug discovery approaches benefit substantially from AI acceleration:

AI ApproachApplication to HI_1086 ResearchPerformance MetricsAdvantages Over Traditional Methods
Deep learning for virtual screeningIdentification of inhibitor candidates15-20× acceleration of hit discoveryIdentifies non-obvious chemical scaffolds
Generative models for compound designDe novo inhibitor creation targeting specific pockets75-200 compounds/week vs. 5-10 manuallyExplores broader chemical space
Graph neural networksPrediction of resistance-conferring mutations82% accuracy in test datasetsEnables proactive inhibitor optimization
Natural language processingAutomated literature mining on ABC transportersProcesses ~2,500 papers/hourIdentifies cross-species functional patterns

Most significantly, AI methods excel at integrating heterogeneous data types—combining structural predictions, transcriptomics, metabolomics, and phenotypic data into unified functional models of HI_1086 activity . These models generate testable hypotheses about substrate specificity, regulatory networks, and physiological roles that would be difficult to formulate through traditional analysis alone. As these technologies mature, they will likely accelerate discovery timelines from years to months and reveal functional insights that might otherwise remain obscure through conventional experimental approaches .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.