Recombinant Haemophilus influenzae Probable D-methionine transport system permease protein metI (metI)

Shipped with Ice Packs
In Stock

Description

Protein Overview

MetI functions as a permease component in the ATP-binding cassette (ABC) transporter complex responsible for importing D-methionine and its toxic analog α-methyl-methionine . Key attributes include:

PropertyDetails
Host OrganismHaemophilus influenzae (strain ATCC 51907/Rd)
Recombinant ExpressionProduced in E. coli with N-terminal 10xHis tag
UniProt IDP46492
Molecular Weight~23 kDa (calculated)
Structural Features213 amino acids, multi-pass membrane protein with 5 transmembrane domains

Transport Mechanism

MetI partners with MetQ (substrate-binding protein) and MetN (ATPase) to form the functional MetNIQ transporter . Key functional data:

  • Substrate Specificity: Translocates D-methionine (Km = 1.16 μM) and α-methyl-methionine

  • Energy Coupling: ATP-dependent transport inhibited by L-methionine

  • Localization: Inner membrane protein with cytoplasmic C-terminus

Regulatory Features

  • Controlled by MetJ repressor via MET box operators

  • Expression inversely correlates with intracellular methionine levels

Biochemical Production Data

Commercial recombinant variants exhibit standardized production parameters:

ParameterSpecification
Expression SystemE. coli in vitro
Purity≥85% (SDS-PAGE)
Storage-20°C/-80°C in Tris/PBS buffer with 6% trehalose
Stability6 months (liquid), 12 months (lyophilized)
Reconstitution0.1-1.0 mg/mL in deionized water + 50% glycerol for long-term storage

Research Applications

  1. Transport Studies: Used to characterize stereospecific methionine uptake in proteoliposome assays

  2. Antibiotic Development: Target for inhibitors disrupting methionine metabolism in pathogenic bacteria

  3. Structural Biology: Serves as template for crystallography of ABC transporter permease domains

Comparative Analysis

Recombinant MetI variants across bacterial species show conserved functional domains:

SpeciesExpression HostSequence IdentityKey Feature
H. influenzae E. coli100%Full-length (1-213) with His-tag
Vibrio cholerae Cell-free system78%VC0906 gene product
Pasteurella multocida Mammalian cells82%Partial sequence (50-200 aa)

Experimental Findings

  • Deletion of metI homologs in E. coli abolishes α-methyl-methionine uptake and confers analog resistance

  • The MetNIQ complex transports both D- and L-methionine isomers, though substrate-binding sites differ

  • Cys residues in transmembrane domains are critical for proton motive force coupling

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type will be decided during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it accordingly.
Synonyms
metI; HI_0620.1; Probable D-methionine transport system permease protein MetI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-213
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
metI
Target Protein Sequence
MWGVVATATYETVYISFASTLLAVLVGVPVGIWTFLTGKNEILQNNRTHFVLNTIINIGR SIPFIILLLILLPVTRFIVGTVLGTTAAIIPLSICAMPFVARLTANALMEIPNGLTEAAQ AMGATKWQIVRKFYLSEALPTLINGVTLTLVTLVGYSAMAGTQGGGGLGSLAINYGRIRN MPYVTWVATIIIVLFVMISQKLGDTLAKKVDHR
Uniprot No.

Target Background

Function
This protein plays a crucial role in the binding-protein-dependent transport system for D-methionine. It is likely responsible for the translocation of the substrate across the membrane.
Protein Families
Binding-protein-dependent transport system permease family, CysTW subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of the D-methionine transport system in Haemophilus influenzae?

The D-methionine transport system in H. influenzae is part of the ATP Binding Cassette (ABC) family of transporters that facilitate the ATP-dependent uptake of methionine and its derivatives. This system consists of multiple components working together to enable substrate transport across the cell membrane. The complete system likely includes:

  • A transmembrane permease component (MetI) that forms the translocation pathway

  • An ATP-binding component that provides energy through ATP hydrolysis

  • A substrate-binding protein that captures the substrate from the periplasm

Based on homology with similar systems such as the E. coli MetNIQ transporter, the H. influenzae system likely operates through conformational changes between inward-facing (IWF) and outward-facing (OWF) states to translocate methionine across the membrane .

How does MetI differ from other components in the methionine transport system?

MetI functions as the permease component of the methionine transport system, forming the transmembrane channel through which methionine and its derivatives pass. While the ATP-binding component (likely MetN in H. influenzae) provides the energy for transport through ATP hydrolysis, and the binding protein (likely MetQ) captures substrate from the periplasm, MetI specifically:

  • Forms the physical pathway through the membrane

  • Undergoes conformational changes during the transport cycle

  • Contains substrate specificity determinants

  • Participates in interactions with both the ATP-binding component and the substrate-binding protein

Unlike MetQ, which can exist independently in the periplasm, MetI is an integral membrane protein that remains embedded in the cytoplasmic membrane .

What expression systems are most effective for producing recombinant H. influenzae MetI?

For recombinant expression of membrane proteins like MetI, the following methodological approach is recommended:

  • Expression system selection: E. coli BL21(DE3) or C41(DE3) strains are often effective for membrane protein expression, with the latter specifically engineered for toxic membrane proteins.

  • Vector design: Incorporate a C-terminal His-tag for purification, preferably with a cleavable linker. The pET system with T7 promoter provides controlled, high-level expression.

  • Expression conditions:

    • Initial induction at OD₆₀₀ = 0.6-0.8

    • IPTG concentration of 0.1-0.5 mM

    • Post-induction growth at lower temperatures (18-25°C) for 4-16 hours to improve folding

  • Membrane extraction protocol:

    • Cell disruption using French press or sonication in buffer containing protease inhibitors

    • Membrane fraction isolation through differential centrifugation (low-speed centrifugation to remove cell debris, followed by ultracentrifugation to collect membranes)

    • Solubilization using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG)

  • Purification strategy:

    • Immobilized metal affinity chromatography (IMAC)

    • Size exclusion chromatography for increased purity

    • Consider co-expression with other components of the transport system for complex stability

What experimental approaches can effectively measure D-methionine transport kinetics mediated by the MetI system?

To effectively measure D-methionine transport kinetics, researchers should consider these methodological approaches:

In vivo transport assays:

  • Generate a knockout strain lacking the native methionine transport systems (ΔmetNIQ)

  • Complement with plasmids expressing wild-type or mutant MetI variants

  • Use D-selenomethionine as a traceable substrate analog that can be quantified by inductively coupled plasma-mass spectrometry (ICP-MS)

  • Measure time-dependent accumulation of D-selenomethionine at varying substrate concentrations

  • Calculate kinetic parameters (Vmax, Km) using Michaelis-Menten analysis

Based on similar studies with the E. coli MetNI system, expected transport rates for functional systems would be approximately 6-10 nmol·min⁻¹·mg⁻¹ of transporter, with turnover times of ~0.02 s⁻¹ .

Reconstituted proteoliposome assays:

  • Purify MetI along with its ATP-binding partner and substrate-binding protein

  • Reconstitute the complete complex into liposomes with controlled lipid composition

  • Establish an ATP regeneration system inside liposomes

  • Add radiolabeled D-methionine externally and measure uptake over time

  • Use rapid filtration or centrifugation techniques to separate liposomes from external media at defined time points

Data analysis considerations:

  • Account for non-specific binding by using control liposomes without transporter

  • Include ATP-depleted controls to verify ATP-dependence

  • Apply appropriate models for cooperative binding if indicated by the data

How do mutations in the MetI permease affect substrate specificity and transport efficiency?

Analyzing the impact of mutations on MetI function requires systematic approaches:

Structure-guided mutation strategy:

  • Target residues in predicted transmembrane regions that line the translocation pathway

  • Focus on conserved residues between H. influenzae MetI and homologs with known structures

  • Generate single point mutations using site-directed mutagenesis

  • Express and purify each variant alongside wild-type controls

Functional assessment methodology:

  • Measure transport rates for multiple substrates (L-methionine, D-methionine, D-selenomethionine)

  • Determine kinetic parameters for each substrate with each MetI variant

  • Calculate specificity constants (kcat/Km) to quantify substrate preference changes

Expected outcomes based on related transporters:
Based on studies of the E. coli methionine transporter, mutations in key residues would likely result in:

  • Altered Km values reflecting changes in substrate binding affinity

  • Changes in Vmax indicating effects on the transport cycle

  • Shifts in substrate preference between L- and D-methionine derivatives

What is the mechanism of interaction between MetI and the substrate-binding protein (SBP) during transport?

The interaction between MetI and its substrate-binding protein involves complex mechanisms that can be studied through multiple approaches:

Canonical vs. noncanonical transport mechanisms:
Based on findings with homologous systems, MetI likely participates in two distinct transport mechanisms:

  • Canonical pathway:

    • The substrate-binding protein binds substrate in the periplasm

    • This substrate-loaded binding protein associates with the MetI-containing transporter

    • ATP binding and hydrolysis drive conformational changes leading to substrate translocation

  • Noncanonical pathway:

    • The unliganded binding protein associates with the ATP-bound MetI-containing transporter

    • Substrate directly binds to this complex through access channels

    • This pathway may be preferentially used for lower-affinity substrates like D-methionine derivatives

Experimental approaches to distinguish between mechanisms:

  • Structural studies:

    • Cryo-EM analysis of the complex in different conformational states

    • Crosslinking studies to capture transient interactions

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

  • Functional studies:

    • Generate binding protein variants with impaired substrate binding

    • Test transport activity with high- and low-affinity substrates

    • Compare transport rates at varying concentrations of free vs. complex-associated binding protein

Evidence from the E. coli MetNIQ system suggests that binding protein variants with impaired substrate binding (e.g., N229A) can actually enhance transport of certain substrates like D-selenomethionine, supporting the existence of the noncanonical pathway .

How does the H. influenzae MetI compare structurally and functionally to homologous proteins in other bacterial species?

Comparative analysis of MetI across bacterial species provides valuable insights:

Structural comparison methodology:

  • Conduct multiple sequence alignments of MetI proteins from diverse bacterial species

  • Generate homology models based on crystal structures of related transporters (e.g., E. coli MetNI, PDB ID: 6CVL)

  • Analyze conservation patterns of transmembrane domains and substrate-binding residues

  • Compare predicted structural features, particularly those forming the translocation pathway

Functional comparison approaches:

  • Express recombinant MetI proteins from different species in a common host

  • Measure transport kinetics under identical conditions

  • Determine substrate specificity profiles for each ortholog

  • Assess the ability of heterologous components to complement function (e.g., can E. coli MetN function with H. influenzae MetI?)

Expected outcomes based on current knowledge:
Based on studies of the E. coli methionine transporter and other ABC transporters, you would likely observe:

  • Conservation of key structural features in the transmembrane domains

  • Species-specific differences in substrate specificity

  • Variation in regulatory mechanisms, particularly in transinhibition properties

  • Differences in transport rates reflective of the metabolic requirements of each organism

What role does the MetI system play in H. influenzae pathogenesis and antibiotic resistance?

The methionine transport system may contribute to H. influenzae pathogenesis through several mechanisms:

Methodological approaches to investigate pathogenesis contributions:

  • Generate MetI knockout strains and assess:

    • Growth in methionine-limited conditions mimicking host environments

    • Survival within macrophages or epithelial cells

    • Ability to form biofilms

    • Virulence in appropriate animal models

  • Analyze expression patterns:

    • Measure MetI expression under infection-relevant conditions

    • Assess MetI upregulation in response to host defense mechanisms

    • Compare expression between invasive and commensal strains

Connection to antibiotic resistance:
The MetI transport system may contribute to antibiotic resistance through:

  • Transport of methionine-derived molecules that contribute to redox homeostasis

  • Potential efflux of certain antibiotics as secondary substrates

  • Contribution to membrane integrity and composition

Experimental design for antibiotic resistance studies:

  • Determine minimum inhibitory concentrations (MICs) for various antibiotics in wild-type vs. MetI-deficient strains

  • Assess the accumulation of fluorescently labeled antibiotics in strains with varying MetI expression

  • Analyze transcriptional responses of MetI to antibiotic exposure

  • Investigate synergistic effects between MetI inhibitors and conventional antibiotics

What protein-protein interaction methods are most suitable for studying MetI associations with other transport components?

For investigating the interactions between MetI and other components of the methionine transport system, several complementary approaches are recommended:

In vitro methods:

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified MetI in supported lipid bilayers or nanodiscs

    • Measure real-time binding kinetics with soluble components

    • Determine association/dissociation rate constants and binding affinities

    • Enable assessment of how nucleotide binding affects interaction dynamics

  • Isothermal Titration Calorimetry (ITC):

    • Directly measure thermodynamic parameters of binding

    • Quantify binding stoichiometry, enthalpy, and entropy changes

    • Assess how substrate binding affects component interactions

    • Example protocol parameters:

      • Cell concentration: 5-10 μM MetI in detergent

      • Syringe concentration: 50-100 μM binding partner

      • Temperature: 25°C

      • Reference power: 5 μcal/sec

  • Pull-down assays with purified components:

    • Immobilize His-tagged MetI using Ni-NTA resin

    • Incubate with potential binding partners under varying conditions

    • Analyze co-precipitated proteins by SDS-PAGE and western blotting

    • Include appropriate controls with non-specific proteins

In vivo methods:

  • Bacterial Two-Hybrid System:

    • Create fusion constructs of MetI and partner proteins with complementary fragments of adenylate cyclase

    • Measure reporter gene expression as indicator of protein interaction

    • Screen for mutations that disrupt interactions

  • FRET-based approaches:

    • Generate fluorescent protein fusions to MetI and binding partners

    • Measure energy transfer as indicator of proximity

    • Monitor dynamic interactions in living cells

  • Co-immunoprecipitation from native membranes:

    • Use antibodies against MetI to precipitate intact complexes

    • Identify interacting partners by mass spectrometry

    • Compare complex composition under varying metabolic conditions

What are the best approaches for studying the regulation of MetI expression in H. influenzae?

Understanding the regulation of MetI expression requires multiple complementary approaches:

Transcriptional regulation analysis:

  • Promoter mapping and characterization:

    • Use 5' RACE to identify transcription start sites

    • Create reporter gene fusions to study promoter activity

    • Perform deletion analysis to identify regulatory regions

    • Use site-directed mutagenesis to confirm specific regulatory elements

  • Identification of transcription factors:

    • Perform DNA-protein pull-down assays using biotinylated promoter fragments

    • Identify bound proteins by mass spectrometry

    • Confirm interactions using electrophoretic mobility shift assays (EMSA)

    • Verify functional significance with genetics approaches

  • Transcriptional profiling:

    • Measure MetI mRNA levels under various growth conditions using qRT-PCR

    • Compare expression in different H. influenzae strains

    • Analyze co-regulated genes using RNA-Seq

Post-transcriptional regulation:

  • mRNA stability assessment:

    • Measure mRNA half-life following transcription inhibition with rifampicin

    • Identify sequence elements affecting stability

    • Investigate the role of small RNAs in regulation

  • Translational regulation:

    • Analyze 5' UTR structure and potential regulatory elements

    • Create translational fusions to reporter genes

    • Investigate the role of RNA-binding proteins

Post-translational regulation:

  • Protein stability and turnover:

    • Pulse-chase experiments with radiolabeled amino acids

    • Western blot analysis following protein synthesis inhibition

    • Identification of proteases involved in MetI degradation

  • Activity regulation:

    • Assess transport activity in membrane vesicles under varying conditions

    • Investigate potential post-translational modifications

    • Study the effects of membrane composition on transport activity

What experimental design considerations are important when evaluating MetI inhibitors as potential antimicrobial agents?

When evaluating inhibitors of the MetI transport system as potential antimicrobial agents, a comprehensive experimental design should include:

Initial inhibitor screening:

  • Transport inhibition assays:

    • Measure D-selenomethionine uptake in the presence of candidate inhibitors

    • Determine IC50 values for promising compounds

    • Assess competitive vs. non-competitive inhibition mechanisms

    • Screen using concentrations ranging from 0.1-100 μM of test compounds

  • Binding assays:

    • Use fluorescence-based thermal shift assays to detect direct binding

    • Confirm interactions using ITC or SPR

    • Determine binding stoichiometry and affinity constants

Antimicrobial activity assessment:

  • Growth inhibition studies:

    • Determine minimum inhibitory concentrations (MICs) against H. influenzae

    • Assess activity against clinical isolates with varying resistance profiles

    • Perform time-kill assays to determine bactericidal vs. bacteriostatic effects

    • Test activity in methionine-limited vs. methionine-rich media

  • Specificity evaluation:

    • Test activity against a panel of bacterial species

    • Assess effects on human cell lines to determine selectivity index

    • Evaluate activity against methionine transport mutants to confirm target

Resistance development assessment:

  • Serial passage experiments:

    • Culture H. influenzae with sub-MIC levels of inhibitors

    • Monitor development of resistance over time

    • Sequence metI and related genes in resistant isolates

    • Determine cross-resistance to other antimicrobials

  • Combination studies:

    • Test inhibitors in combination with conventional antibiotics

    • Calculate fractional inhibitory concentration (FIC) indices

    • Identify synergistic combinations for further development

Pharmacological characterization:

  • Physical property assessment:

    • Determine solubility, lipophilicity, and chemical stability

    • Assess membrane permeability using PAMPA or Caco-2 assays

    • Evaluate plasma protein binding

  • Preliminary pharmacokinetics:

    • Measure metabolic stability in liver microsomes

    • Determine half-life in serum

    • Assess cytochrome P450 inhibition potential

How can researchers effectively design mutational studies to understand the structure-function relationship of MetI?

To effectively design mutational studies that illuminate the structure-function relationship of MetI, researchers should implement the following methodological framework:

Selection of mutation targets:

  • Bioinformatic analysis:

    • Perform multiple sequence alignments across diverse bacterial species

    • Identify highly conserved residues as potential functional determinants

    • Use homology modeling based on related structures (e.g., E. coli MetI)

    • Predict transmembrane topology to locate residues lining the translocation pathway

  • Structural considerations:

    • Target residues in predicted substrate-binding pockets

    • Focus on regions involved in conformational changes

    • Identify residues at interfaces with other transport components

    • Examine regions implicated in the canonical vs. noncanonical transport pathways

Mutation strategy:

  • Substitution design:

    Mutation TypePurposeExample
    ConservativeMaintain chemical propertiesLeu→Ile, Asp→Glu
    Non-conservativeTest chemical requirementsLeu→Ala, Asp→Asn
    Charge reversalTest electrostatic interactionsAsp→Lys, Lys→Glu
    Proline introductionDisrupt secondary structureX→Pro in helices
    Cysteine scanningEnable crosslinking studiesX→Cys pairs
  • Comprehensive approach:

    • Create alanine scanning libraries across functional domains

    • Generate double mutants to test functional coupling

    • Create chimeric proteins with related transporters to define specificity determinants

Functional assessment:

  • Expression and localization verification:

    • Confirm proper membrane insertion using GFP fusions

    • Verify expression levels by western blotting

    • Assess membrane localization by fractionation and imaging

  • Transport activity measurement:

    • Quantify transport rates using D-selenomethionine uptake assays

    • Determine Km and Vmax for multiple substrates

    • Compare transport efficiency of different MetI variants

    • Expected wild-type parameters: Km ~1.8 μM, Vmax ~6-10 nmol·min⁻¹·mg⁻¹

  • Conformational dynamics analysis:

    • Use EPR spectroscopy with spin-labeled cysteine mutants

    • Perform limited proteolysis to assess structural integrity

    • Apply hydrogen-deuterium exchange mass spectrometry to map conformational changes

Data interpretation framework:

  • Functional classification of mutations:

    • Expression/folding defects: Reduced protein levels despite normal mRNA

    • Assembly defects: Normal expression but impaired complex formation

    • Substrate binding defects: Increased Km without affecting Vmax

    • Translocation defects: Reduced Vmax without affecting Km

    • Regulation defects: Altered response to inhibitory signals

  • Integration with structural data:

    • Map mutational effects onto structural models

    • Identify functional hotspots and domains

    • Develop testable hypotheses about the transport mechanism

What are the optimal conditions for purifying functional recombinant MetI for structural and biochemical studies?

Optimizing purification conditions for MetI requires careful consideration of membrane protein biochemistry:

Solubilization optimization:

  • Detergent screening:

    DetergentPropertiesStarting Concentration
    DDMMild, widely used1%
    LMNGEnhanced stability0.1%
    DigitoninNative-like environment1%
    GDNStabilizes complexes0.1%
    SMA copolymerExtracts native lipid environment2.5%
  • Solubilization conditions:

    • Buffer composition: 50 mM Tris-HCl pH 7.5, 150-300 mM NaCl, 10% glycerol

    • Include stabilizing additives: 1 mM DTT, protease inhibitors

    • Perform solubilization at 4°C for 1-2 hours with gentle agitation

    • Remove insoluble material by ultracentrifugation (100,000 × g, 30 min)

Purification strategy:

  • Affinity chromatography:

    • Use immobilized metal affinity chromatography (IMAC) with Ni-NTA or TALON resin

    • Employ step gradients of imidazole (10 mM wash, 250-300 mM elution)

    • Include 0.5-3× critical micelle concentration (CMC) of detergent in all buffers

    • Consider on-column detergent exchange if needed

  • Size exclusion chromatography:

    • Apply concentrated sample (5-10 mg/ml) to Superdex 200 column

    • Use buffer containing 20 mM HEPES pH 7.5, 150 mM NaCl, detergent at 2× CMC

    • Analyze elution profile to confirm monodispersity

    • Collect peak fractions and analyze by SDS-PAGE

  • Co-purification considerations:

    • For structural studies, co-express and co-purify with ATP-binding component

    • Include 1-5 mM ATP or non-hydrolyzable analog (AMP-PNP) in buffers

    • Consider lipid supplementation (0.1-0.2 mg/ml E. coli lipid extract)

Functional verification:

  • Detergent removal methods:

    • Reconstitution into proteoliposomes using established protocols

    • Bio-Beads SM-2 removal of detergent during liposome formation

    • Lipid-to-protein ratio optimization (typically 50:1 to 200:1 w/w)

  • Activity measurements:

    • ATPase activity using colorimetric phosphate release assays

    • Transport activity in reconstituted proteoliposomes

    • Substrate binding using fluorescence-based assays

Quality control metrics:

  • Purity assessment:

    • 95% purity by SDS-PAGE and Coomassie staining

    • Single, symmetric peak by size exclusion chromatography

    • Absence of aggregated material by dynamic light scattering

  • Stability evaluation:

    • Thermal stability using differential scanning fluorimetry

    • Long-term stability at 4°C and -80°C

    • Freeze-thaw tolerance in the presence of cryoprotectants

How can researchers accurately quantify the binding affinity between MetI and its substrates?

Accurately quantifying the binding affinity between MetI and its substrates requires specialized approaches for membrane proteins:

Direct binding measurement techniques:

  • Microscale Thermophoresis (MST):

    • Label purified MetI with fluorescent dye (typically at N- or C-terminus)

    • Prepare serial dilutions of substrate (D-methionine, D-selenomethionine)

    • Measure changes in thermophoretic movement upon binding

    • Calculate Kd values from binding curves

    • Advantages: Requires small sample amounts, works in detergent solutions

  • Isothermal Titration Calorimetry (ITC):

    • Measure heat changes upon substrate binding to purified MetI

    • Determine thermodynamic parameters (ΔH, ΔS, ΔG)

    • Calculate binding stoichiometry and affinity

    • Advantages: Label-free, provides complete thermodynamic profile

    • Limitations: Requires large protein amounts, may be complicated by detergent

  • Surface Plasmon Resonance (SPR):

    • Immobilize MetI on sensor chip via His-tag or biotinylation

    • Flow substrate solutions at varying concentrations

    • Measure real-time binding and dissociation

    • Calculate kon, koff, and Kd values

    • Advantages: Real-time kinetics, small sample requirements

Indirect binding measurement techniques:

  • Fluorescence-based assays:

    • Utilize intrinsic tryptophan fluorescence changes upon substrate binding

    • Alternatively, use environment-sensitive fluorescent labels at strategic positions

    • Titrate with increasing substrate concentrations

    • Fit data to appropriate binding models to determine Kd

  • Competition assays:

    • Use a reference substrate with known binding properties

    • Perform displacement experiments with test substrates

    • Calculate relative binding affinities from IC50 values

  • Transport kinetics as proxy:

    • Measure transport rates at varying substrate concentrations

    • Determine Km values as approximations of binding affinity

    • Expected Km values for D-methionine derivatives: 1.8-7.4 μM

Experimental considerations:

  • Sample preparation:

    • Ensure protein stability and monodispersity throughout experiments

    • Verify that detergent or lipid environment mimics native membrane

    • Control for non-specific binding to detergent micelles

  • Data analysis:

    • Apply appropriate binding models (single-site, multiple sites, cooperative)

    • Account for background signal and non-specific binding

    • Calculate confidence intervals for all derived parameters

  • Validation approaches:

    • Compare affinity values across multiple techniques

    • Verify with mutants predicted to affect binding

    • Correlate binding affinity with transport kinetics

What emerging technologies could advance our understanding of MetI structure and function?

Several cutting-edge technologies hold promise for advancing our understanding of the MetI transport system:

Advanced structural biology approaches:

  • Cryo-electron microscopy (cryo-EM):

    • Single-particle analysis for high-resolution structures

    • Capture multiple conformational states during transport cycle

    • Visualize MetI in complex with other transport components

    • Time-resolved studies to capture transient intermediates

  • Integrative structural biology:

    • Combine X-ray crystallography, cryo-EM, and NMR data

    • Incorporate crosslinking-mass spectrometry for interface mapping

    • Use molecular dynamics simulations to model conformational changes

    • Apply hydrogen-deuterium exchange mass spectrometry to map dynamic regions

  • In situ structural techniques:

    • Electron tomography of MetI in native membranes

    • Correlative light and electron microscopy to locate and visualize transporters

    • In-cell NMR to study dynamics in living bacteria

Functional characterization innovations:

  • Single-molecule approaches:

    • Fluorescence resonance energy transfer (FRET) to monitor conformational changes

    • High-speed atomic force microscopy to visualize structural dynamics

    • Electrical recording of individual transport events using nanopore technology

  • Advanced transport assays:

    • Microfluidic devices for high-throughput transport measurements

    • Real-time monitoring of substrate flux in single bacterial cells

    • Development of fluorescent substrate analogs for live-cell imaging

  • Protein engineering approaches:

    • Split-protein complementation to monitor assembly of transport complexes

    • Incorporation of unnatural amino acids for site-specific labeling

    • Creation of light-responsive variants for optogenetic control of transport

Computational advances:

  • Enhanced simulation techniques:

    • Long-timescale molecular dynamics simulations of complete transport cycle

    • Enhanced sampling methods to identify rate-limiting steps

    • Quantum mechanical/molecular mechanical (QM/MM) simulations of substrate binding

  • Artificial intelligence applications:

    • Machine learning for prediction of transport kinetics from sequence

    • Neural networks for identification of novel inhibitors

    • Structure prediction algorithms specifically optimized for membrane proteins

Systems biology integration:

  • Multi-omics approaches:

    • Integrate transcriptomics, proteomics, and metabolomics data

    • Map MetI-dependent metabolic networks

    • Identify condition-specific regulation of transport activity

  • Bacterial physiology connections:

    • High-throughput phenotyping of MetI variants in diverse conditions

    • Single-cell analysis of transport activity heterogeneity

    • Investigation of MetI's role in bacterial communities and biofilms

What are the potential applications of MetI research in therapeutic development and bacterial physiology studies?

Research on the MetI transport system has several promising applications:

Therapeutic development opportunities:

  • Novel antimicrobial strategies:

    • Design of specific MetI inhibitors as narrow-spectrum antibiotics

    • Development of "Trojan horse" compounds using MetI as entry point

    • Creation of vaccines targeting extracellular portions of the transport system

  • Biotechnological applications:

    • Engineering H. influenzae strains with modified methionine transport for vaccine production

    • Development of biosensors based on MetI for detecting methionine derivatives

    • Creation of bacterial screening systems for drug discovery

  • Combination therapy approaches:

    • Identification of synergistic interactions between MetI inhibitors and conventional antibiotics

    • Development of adjuvants that increase antibiotic efficacy by modulating methionine transport

    • Design of targeted delivery systems for existing antibiotics

Bacterial physiology insights:

  • Metabolic regulation understanding:

    • Elucidation of methionine's role in H. influenzae metabolism

    • Investigation of connections between methionine transport and redox homeostasis

    • Characterization of MetI's role in amino acid sensing and metabolic adaptation

  • Host-pathogen interaction studies:

    • Analysis of methionine availability in host niches

    • Investigation of methionine transport modulation during infection

    • Understanding of methionine's role in biofilm formation and persistence

  • Evolution and adaptation research:

    • Comparative analysis of methionine transport systems across bacterial species

    • Investigation of MetI sequence variation in clinical isolates

    • Study of transport system adaptations to different host environments

Methodological advances:

  • Membrane protein research tools:

    • Development of improved expression and purification protocols

    • Creation of novel assays for transport activity

    • Establishment of screening platforms for membrane protein-targeted drugs

  • Structural biology applications:

    • Use of MetI as a model system for studying ABC transporter conformational changes

    • Development of stabilization strategies for membrane protein crystallization

    • Advancement of computational methods for predicting transport mechanisms

How can researchers overcome common obstacles in recombinant MetI expression and purification?

When working with recombinant MetI, researchers frequently encounter several challenges that can be addressed with these methodological solutions:

Expression challenges:

  • Low expression levels:

    • Optimize codon usage for expression host

    • Test different promoter strengths and induction conditions

    • Screen multiple fusion tags (His, MBP, SUMO) for improved expression

    • Consider specialized expression hosts like C41(DE3) or Lemo21(DE3)

    • Recommended protocol: Test expression at 18°C, 25°C, and 37°C with IPTG concentrations ranging from 0.1-1.0 mM

  • Protein toxicity:

    • Use tightly regulated expression systems with minimal leaky expression

    • Lower induction temperature to 16-18°C

    • Reduce inducer concentration (0.1 mM IPTG or lower)

    • Consider auto-induction media for gradual protein production

  • Inclusion body formation:

    • Co-express with molecular chaperones (GroEL/ES, DnaK/J)

    • Add membrane-stabilizing compounds to growth media (glycerol, specific lipids)

    • Consider fusion to solubilizing partners like MBP or SUMO

Solubilization and purification obstacles:

  • Inefficient solubilization:

    • Systematic detergent screening protocol:

      • Test panel of detergents: DDM, LMNG, UDM, Triton X-100, CHAPS

      • Vary detergent concentration from 0.5-2% for initial extraction

      • Optimize solubilization time (1 hour to overnight)

      • Include stabilizing additives (glycerol, cholesterol hemisuccinate)

  • Protein instability:

    • Add stabilizing ligands throughout purification (ATP/ADP, methionine derivatives)

    • Incorporate lipids during purification (0.1-1.0 mg/ml E. coli lipid extract)

    • Use gel filtration immediately after affinity purification to remove aggregates

    • Consider nanodiscs or SMALPs for a more native-like environment

  • Low purity:

    • Implement two-step affinity purification with orthogonal tags

    • Use ion exchange chromatography as intermediate step

    • Apply stringent washing conditions during affinity purification

    • Consider on-column detergent exchange to remove contiguous proteins

Functional assessment challenges:

  • Loss of activity during purification:

    • Verify proper folding using CD spectroscopy or limited proteolysis

    • Test functionality in different reconstitution systems (proteoliposomes, nanodiscs)

    • Assess ATP binding using fluorescent ATP analogs

    • Co-purify with other components of the transport system for stability

  • Variable reconstitution efficiency:

    • Systematically optimize lipid composition

    • Test different reconstitution methods (dialysis vs. Bio-Beads)

    • Verify correct orientation in liposomes using protease protection assays

    • Control protein-to-lipid ratios precisely (typically 1:100 to 1:1000 w/w)

Assay reproducibility issues:

  • Standardization of cell preparations:

    • Harvest cells at consistent OD₆₀₀ values (typically 0.6-0.8)

    • Standardize growth conditions (media composition, temperature, aeration)

    • Use fresh transformants rather than repeatedly passaged strains

    • Implement precise cell density normalization for uptake assays

  • Substrate preparation considerations:

    • Prepare fresh substrate solutions for each experiment

    • Verify substrate purity by HPLC or mass spectrometry

    • Control for potential substrate degradation or modification

    • For D-selenomethionine assays, protect from oxidation

  • Critical controls:

    Control TypePurposeExpected Result
    No-transporterBackground uptake<10% of active transport
    ATP-depletedEnergy requirement<15% of normal activity
    Competitive inhibitionSpecificity>70% reduction with excess unlabeled substrate
    Temperature control (4°C)Active vs. passive<20% of room temperature activity

Technical variability sources:

  • Sample processing inconsistencies:

    • Implement automated sampling where possible

    • Standardize washing procedures for filters

    • Use internal standards for normalization

    • Establish precise timing protocols for kinetic measurements

  • Detection method optimization:

    • For ICP-MS detection of D-selenomethionine:

      • Use collision/reaction cell technology to reduce interferences

      • Include internal standards (e.g., gallium) for drift correction

      • Run calibration standards throughout sample sequence

      • Expected detection limits: 0.1-1.0 μg/L selenium

  • Data analysis standardization:

    • Apply consistent curve-fitting algorithms

    • Establish clear criteria for outlier exclusion

    • Use appropriate kinetic models (Michaelis-Menten, Hill equation)

    • Report uncertainty ranges for all derived parameters

Biological variability management:

  • Expression level variations:

    • Quantify transporter expression in each experiment

    • Normalize transport rates to protein levels

    • Consider inducible expression systems with tighter control

    • Verify membrane localization by fractionation

  • Strain background effects:

    • Use isogenic strains for all comparisons

    • Complement knockout strains with plasmid-borne genes

    • Account for potential polar effects in operon disruptions

    • Verify absence of suppressor mutations

  • Media and growth condition effects:

    • Standardize pre-culture conditions

    • Control methionine levels in growth media

    • Account for growth phase effects on transport activity

    • Measure and report cell viability alongside transport data

Systematic troubleshooting approach:

For addressing persistent variability, implement this hierarchical investigation process:

  • Technical validation: Repeat measurements with technical replicates

  • Biological validation: Test with independent biological samples

  • Method validation: Compare different detection methods

  • Component testing: Systematically vary assay components to identify sources of variability

  • Statistical validation: Apply appropriate statistical tests for significance

Expected performance metrics for a well-optimized D-selenomethionine transport assay:

  • Technical replicate variability: CV < 10%

  • Biological replicate variability: CV < 20%

  • Signal-to-noise ratio: > 10:1

  • Dynamic range: At least 2 orders of magnitude

  • Z-factor for high-throughput screens: > 0.5

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.