Recombinant Haemophilus influenzae Probable intracellular septation protein A (NTHI0991)

Shipped with Ice Packs
In Stock

Description

Protein Characteristics

NTHI0991 is encoded by the gene locus NTHI0991 in NTHi strain 86-028NP (UniProt: Q4QM74). Key attributes include:

AttributeDetails
Molecular Weight~21 kDa (predicted for 185-amino-acid sequence)
Expression HostRecombinant expression system (unspecified)
TagDetermined during production (commonly His-tag or GST for purification)
StorageTris-based buffer with 50% glycerol; store at -20°C or -80°C
SequenceFull-length (1–185 amino acids): MKQLLDFIPLILFFITYKLGGVREAAIVLVVATILQIVILKWKYGIVEKQQKIMASAVVFFGLLTAYFNEIRYLQWKVTIINGLFAIVLLVAQFQFKTPLIKKLLGKELQLPEKAWNTLNLGWALFFIICmLVNIYISHNMSEEAWVDFKSFGIIGMTVIATIISGVYIYRYLPKDGSNSKDGEK

Septation and Cellular Function

NTHI0991 is annotated as a probable intracellular septation protein, suggesting involvement in bacterial cell division. While direct evidence for its role in NTHi septation is limited, studies on homologous proteins in other Gram-negative bacteria indicate that septation proteins often regulate peptidoglycan remodeling or coordinate cell wall synthesis during division .

Association with Virulence

Though not directly linked to adhesion or immune evasion mechanisms like ICAM-1 binding (a trait of other NTHi surface proteins ), NTHI0991 may contribute to bacterial survival. Genome-wide analyses of NTHi strains reveal that surface-associated proteins, including septation factors, often correlate with clade-specific virulence . For example:

  • Clade-specific distribution of proteins such as Hap, Hia/Hsf, and HMW1/2 influences colonization and pathogenicity [5

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery time estimates, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference point for your own preparations.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
yciB; NTHI0991; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Haemophilus influenzae (strain 86-028NP)
Target Names
NTHI0991
Target Protein Sequence
MKQLLDFIPLILFFITYKLGGVREAAIVLVVATILQIVILKWKYGIVEKQQKIMASAVVF FGLLTAYFNEIRYLQWKVTIINGLFAIVLLVAQFQFKTPLIKKLLGKELQLPEKAWNTLN LGWALFFIICMLVNIYISHNMSEEAWVDFKSFGIIGMTVIATIISGVYIYRYLPKDGSNS KDGEK
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links

KEGG: hit:NTHI0991

Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does NTHI0991 compare to similar proteins in other bacterial species?

Septation proteins are conserved across many bacterial species as they are involved in the fundamental process of cell division. NTHI0991, as a probable intracellular septation protein, shares homology with other septation proteins in gram-negative bacteria.

Methodology for comparison:

  • Perform sequence alignment using tools like BLAST or Clustal Omega to identify homologs

  • Compare protein domains and motifs using InterPro or SMART

  • Analyze protein structure predictions using AlphaFold or similar tools

  • Create phylogenetic trees to visualize evolutionary relationships

NTHI0991 can be compared to proteins with similar functions in other respiratory pathogens such as Moraxella catarrhalis and Streptococcus pneumoniae to identify conserved regions that may be essential for function .

What is known about the expression pattern of NTHI0991 during different growth phases?

  • qRT-PCR to measure mRNA expression levels at different growth stages

  • Western blotting with anti-NTHI0991 antibodies to detect protein levels

  • Reporter gene assays (e.g., using GFP fusions) to monitor expression in real-time

  • RNA-seq to analyze transcriptomic profiles at different growth stages

Like other septation proteins, NTHI0991 expression may increase during active cell division phases. Unlike surface-exposed proteins such as EF-Tu, which has been well-characterized in H. influenzae , intracellular proteins like NTHI0991 may have more consistent expression patterns regardless of the host environment.

What are the optimal conditions for expressing recombinant NTHI0991 protein?

For optimal expression of recombinant NTHI0991:

  • Expression system selection:

    • E. coli BL21(DE3) is commonly used for recombinant protein expression

    • Consider codon optimization for E. coli if expression yields are low

  • Vector considerations:

    • Use vectors with strong inducible promoters (e.g., T7)

    • Include appropriate tags (His-tag, GST) for purification

    • Signal peptide analysis should be performed since this appears to be a membrane protein

  • Expression conditions:

    • Induction at OD600 of 0.6-0.8

    • IPTG concentration: 0.1-1.0 mM

    • Post-induction growth at lower temperatures (16-25°C) to improve protein folding

    • Consider using specialized media (e.g., auto-induction media)

  • Purification strategy:

    • Membrane protein extraction may require detergents

    • Affinity chromatography based on the chosen tag

    • Size exclusion chromatography for final purification

Similar approaches have been successful for other H. influenzae proteins as seen in the EF-Tu studies .

How can researchers validate the function of NTHI0991 in cell division processes?

Functional validation approaches:

  • Gene knockout/knockdown:

    • Create NTHI0991 deletion mutants using homologous recombination

    • Analyze cell morphology and division rates

    • Complement the mutation to confirm phenotype rescue

  • Fluorescence microscopy:

    • GFP-tagging of NTHI0991 to visualize localization during cell division

    • Time-lapse imaging to track protein dynamics during septation

    • Co-localization with other known division proteins (FtsZ, MinC, etc.)

  • Protein-protein interaction studies:

    • Bacterial two-hybrid assays to identify interaction partners

    • Co-immunoprecipitation followed by mass spectrometry

    • Surface plasmon resonance to quantify binding affinities

  • Cell division assays:

    • Growth curve analysis of wild-type vs. mutant strains

    • Microscopy-based septation analyses

    • Cell synchronization experiments to study division-specific events

These methodologies would help establish NTHI0991's role in bacterial cell division, similar to approaches used for studying other intracellular bacterial processes in H. influenzae .

What methodologies are recommended for studying NTHI0991 during host cell infection?

To study NTHI0991 during host cell infection:

  • Infection models:

    • Human respiratory epithelial cell lines (e.g., A549, BEAS-2B)

    • Primary human bronchial epithelial cells grown at air-liquid interface

    • Mouse infection models for in vivo studies

  • Protein expression analysis:

    • qRT-PCR to measure NTHI0991 expression during different infection stages

    • Western blot using cell fractionation to separate bacterial and host proteins

    • Immunofluorescence microscopy with specific antibodies

  • Functional studies during infection:

    • Compare wild-type and NTHI0991 mutant strains in:

      • Invasion assays (gentamicin protection assay)

      • Intracellular survival kinetics

      • Host cell response measurements (cytokine production, etc.)

  • Trafficking studies:

    • Combine fluorescently labeled bacteria with markers of host cell compartments

    • Live-cell imaging to track bacterial movement within host cells

    • Correlative light and electron microscopy for ultrastructural details

This approach builds on established methods used for studying NTHi invasion and intracellular survival in host respiratory cells .

How might NTHI0991 contribute to H. influenzae pathogenicity and intracellular survival?

While direct evidence for NTHI0991's role in pathogenicity is limited, several research directions can be explored:

  • Potential roles based on septation function:

    • Proper cell division is essential for bacterial fitness during infection

    • Disruption may affect growth rates within host cells

    • May influence bacterial morphology, potentially affecting host recognition

  • Comparison with other pathogens:

    • Septation proteins in other bacteria have been linked to stress resistance

    • Some division proteins are repurposed during infection to promote survival

  • Intracellular environment adaptation:

    • H. influenzae is known to invade epithelial cells and survive intracellularly

    • Cell division regulation may be critical for establishing persistent infections

    • May coordinate with stress response systems during intracellular residence

  • Experimental approaches to test pathogenicity contributions:

    • Animal infection models comparing wild-type vs. NTHI0991 mutants

    • Competition assays between strains

    • Transcriptomic profiling during infection to identify co-regulated virulence factors

Unlike surface-exposed proteins such as EF-Tu that directly interact with host components , intracellular proteins like NTHI0991 would likely contribute to pathogenicity through maintaining bacterial physiological processes during infection.

What is the relationship between NTHI0991 and other known virulence factors in H. influenzae?

Research methodologies to explore these relationships:

  • Genetic interaction studies:

    • Create double mutants (NTHI0991 + known virulence factor)

    • Analyze epistatic effects on virulence phenotypes

    • Transposon-sequencing (Tn-seq) to identify genetic interactions

  • Transcriptomic approaches:

    • RNA-seq comparing NTHI0991 mutants vs. wild-type

    • Identify co-regulated genes in different infection conditions

    • ChIP-seq if transcriptional regulation is suspected

  • Proteomic analyses:

    • Compare protein expression profiles between strains

    • Identify protein-protein interactions via pull-down assays

    • Analyze post-translational modifications

  • Functional correlation studies:

    • Compare phenotypes with known virulence pathways:

      • IgA1 protease expression and function

      • Adhesin (e.g., Hap) activity

      • Invasion and intracellular trafficking

While EF-Tu has been shown to moonlight as a surface protein that can be targeted by bactericidal antibodies , NTHI0991's intracellular location suggests different virulence mechanisms, possibly related to optimizing bacterial replication during intracellular stages of infection.

How can structural studies of NTHI0991 inform drug development strategies?

Advanced structural biology approaches for NTHI0991:

  • Protein structure determination:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy for larger complexes

    • NMR for smaller domains or fragments

    • Computational structure prediction (AlphaFold2)

  • Structure-based drug design process:

    • Identify potential binding pockets through computational analysis

    • Virtual screening of compound libraries against the structure

    • Fragment-based approaches to develop lead compounds

    • Molecular dynamics simulations to understand protein flexibility

  • Experimental validation:

    • Thermal shift assays to confirm compound binding

    • Surface plasmon resonance for binding kinetics

    • Activity assays to confirm functional inhibition

    • Crystallization of protein-inhibitor complexes

  • Design considerations specific to septation proteins:

    • Focus on conserved active sites across bacterial species

    • Target regions unique to bacterial septation (not present in humans)

    • Consider membrane accessibility of binding sites

    • Evaluate essentiality through gene knockout studies

Unlike surface proteins that can be targeted by antibodies, intracellular proteins like NTHI0991 would require small molecule inhibitors capable of penetrating the bacterial cell envelope, presenting both challenges and opportunities for novel antimicrobial development .

What are the challenges in developing antibodies against NTHI0991 for research applications?

Challenges and methodological solutions:

  • Protein expression and purification challenges:

    • Membrane protein solubility issues

    • Solution: Use detergent solubilization or membrane-mimetic systems

    • Alternative: Express soluble domains separately

  • Antibody generation strategies:

    • Select antigenic peptides using epitope prediction tools

    • Consider peptide synthesis for difficult regions

    • Use multiple hosts (rabbit, mouse, chicken) for diverse antibody repertoires

    • Validate with Western blot, immunoprecipitation, and immunofluorescence

  • Cross-reactivity considerations:

    • Test against related proteins from other Haemophilus species

    • Validate with knockout strains as negative controls

    • Pre-adsorb antibodies against related proteins if necessary

  • Application-specific optimization:

    • For flow cytometry: optimize fixation/permeabilization

    • For immunoelectron microscopy: validate specific labeling conditions

    • For immunofluorescence: determine optimal fixation methods

Unlike EF-Tu, which has been successfully used to raise antibodies that recognize surface-exposed epitopes , NTHI0991 antibodies would primarily be useful for research applications requiring cell permeabilization to access the intracellular protein.

How can systems biology approaches integrate NTHI0991 into broader understanding of H. influenzae adaptation during infection?

Systems biology methodologies:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Develop network models of protein-protein interactions

    • Use computational modeling to predict system perturbations

    • Data collection at multiple infection timepoints

  • Network analysis techniques:

    • Construct protein interaction networks

    • Identify hubs and bottlenecks in metabolic pathways

    • Compare networks between commensal and pathogenic states

    • Use graph theory to identify critical nodes

  • Experimental validation of predictions:

    • CRISPR interference for temporal gene regulation

    • Targeted metabolomics to validate predicted metabolic shifts

    • Fluorescent reporters to track network dynamics in real-time

    • Single-cell approaches to capture population heterogeneity

  • Comparative systems approaches:

    • Compare response networks across different H. influenzae strains

    • Analyze system differences between encapsulated and non-encapsulated strains

    • Contrast with other respiratory pathogens like M. catarrhalis

This systems biology framework would place NTHI0991 within the broader context of H. influenzae adaptation during host invasion and intracellular survival, complementing the more targeted studies of individual virulence factors and invasion mechanisms described in the literature .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.