Recombinant Haemophilus influenzae Probable protease sohB (sohB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is assigned during production. If you require a specific tag, please inform us, and we will prioritize its incorporation.
Synonyms
sohB; HI_1682; Probable protease SohB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
sohB
Target Protein Sequence
MLNDILTGYGIFILEILTILLLILAVVGLIISYRQHNKSKVGELEIKDLSEEFNEQVRLL RDFNLSEEEQKQRTKAEKKAEKQNAKKRKEKLKKGETLEDEKKACVYVLDFCGDISASET TALREEISAILNVAKSEDEVLLRLESPGGIVHNYGFAASQLSRLKQKGIKLTVAVDKVAA SGGYMMACVADKIVSAPFAVIGSIGVVAQIPNVHRLLKKHDVDVDVMTAGEFKRTVTVLG ENTEKGKQKFQQELEETHKLFKQFVSQNRPCLDIDKIATGEHWFGQQAIALQLVDEISTS DDLILEKMKEKQVLNVKYRLKKSLIKKFGRQAEESAINIIHRYSTKQSRDFMY
Uniprot No.

Target Background

Function
Probable protease.
Database Links

KEGG: hin:HI1682

STRING: 71421.HI1682

Protein Families
Peptidase S49 family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the sohB protein and what is its role in Haemophilus influenzae?

The sohB protein in Haemophilus influenzae is classified as a probable protease with the EC number 3.4.21.-. It is a transmembrane protein that appears to function as a periplasmic protease, playing a role in protein quality control mechanisms . Based on structural and sequence homology studies, sohB belongs to a family of proteases that includes the E. coli protease IV (encoded by the sppA gene) and shows similarities to the product of the vcaC morphogenetic gene of bacteriophage X . This suggests evolutionary conservation of this protease across diverse bacterial species, indicating its fundamental importance in bacterial physiology.

What are the key structural characteristics of the sohB protein?

The full-length sohB protein from Haemophilus influenzae consists of 353 amino acids with multiple distinguishing structural features. It contains a signal sequence at the N-terminus (approximately the first 22 amino acids) that directs its export from the cytoplasm, which is cleaved to produce the mature protein form of approximately 37 kDa (compared to the 39 kDa precursor) . Computer analysis has identified a potential transmembrane spanning domain approximately between amino acids 190-210, predicted by multiple membrane-association prediction algorithms (HELIXMEM, RAOARGOS, and SOAP) .

The protein sequence includes multiple hydrophobic regions, with particularly pronounced hydrophobicity at the N-terminal signal sequence and within the central transmembrane domain. The processed mature protein localizes to the periplasmic space, where it likely performs its proteolytic functions .

How is the sohB gene organized in the genome?

The sohB gene in Escherichia coli (which has been more extensively studied than the Haemophilus influenzae ortholog) is positioned upstream of the topA gene, with approximately 600 bp separating the end of sohB and the start of topA . Initial sequencing predicted a larger intergenic region of 900 bp, but further analysis revealed a frameshift in the originally published sequence that extended the actual ORF by approximately 300 bp . The gene begins with a GTG initiation codon rather than the more common ATG, which is an important consideration when designing expression constructs for recombinant production .

What expression systems are most effective for recombinant sohB production?

For recombinant production of H. influenzae sohB, in vitro E. coli expression systems have proven successful and are the most commonly utilized approach . The protein can be expressed with an N-terminal 10xHis-tag to facilitate purification while maintaining the functionality of the protein . Alternative expression hosts including yeast, baculovirus-infected insect cells, and mammalian cell systems have also been employed, particularly when specific post-translational modifications or folding environments are required .

Cell-free expression systems represent another viable option, especially useful when rapid production is needed or when the protein might be toxic to living cells . When designing expression constructs, it is critical to consider the presence of the native signal sequence and determine whether it should be included or replaced with a system-appropriate secretion signal, depending on the desired subcellular localization and downstream applications.

How should recombinant sohB be stored to maintain stability and activity?

Storage recommendations for recombinant sohB protein are critical to prevent activity loss. The optimal storage conditions include:

Storage DurationTemperatureFormAdditional Recommendations
Short-term (up to 1 week)4°CWorking aliquotsAvoid repeated freeze-thaw cycles
Medium-term (up to 6 months)-20°CLiquidMaintain in appropriate buffer
Long-term (up to 12 months)-20°C to -80°CLyophilizedProtect from moisture

For extended storage, it is advisable to conserve the protein at -80°C to minimize degradation . The shelf life of the protein is influenced by multiple factors including the specific buffer components, the presence of stabilizing agents, and the inherent stability of the protein itself . When working with the protein, creating single-use aliquots is strongly recommended to avoid the detrimental effects of repeated freeze-thaw cycles on protein structure and function.

What purification methods yield the highest purity of recombinant sohB?

Purification of His-tagged recombinant sohB typically employs immobilized metal affinity chromatography (IMAC) as the primary capture step. This approach consistently yields preparations with ≥85% purity as determined by SDS-PAGE analysis . To achieve higher purity for specialized applications, additional purification steps may be necessary:

  • Size exclusion chromatography to separate monomeric sohB from aggregates and remove any remaining contaminants of significantly different molecular weight

  • Ion exchange chromatography to exploit the charge characteristics of the protein

  • Hydrophobic interaction chromatography when appropriate for the specific construct

When designing a purification strategy, it's important to consider that sohB is a membrane-associated protein with hydrophobic regions. Therefore, the buffer composition may need to include mild detergents or amphipathic agents to maintain solubility throughout the purification process while preserving the native structure and function of the protease.

How does the proteolytic function of sohB compare to other bacterial proteases?

The sohB protein belongs to a family of serine proteases with the EC classification 3.4.21.- . Sequence analysis reveals significant homology with E. coli protease IV (encoded by the sppA gene) and the product of the vcaC morphogenetic gene of bacteriophage X . This suggests a conserved catalytic mechanism among these proteases.

Unlike classical secreted proteases, sohB functions as a membrane-associated periplasmic protease, indicating its role in regulated proteolysis rather than nutritional degradation of extracellular proteins . A distinctive feature of sohB is its ability to partially compensate for the function of the HtrA (DegP) protease when overexpressed, suggesting overlapping substrate specificity or parallel quality control pathways . This functional redundancy provides an important perspective on bacterial stress response mechanisms and protein quality control systems.

When designing experiments to assess sohB proteolytic activity, researchers should consider:

  • The potential requirement for membrane components or specific lipid environments

  • The likely narrow substrate specificity typical of quality control proteases

  • The potential influence of environmental factors such as pH, temperature, and ionic strength on activity

What experimental approaches can be used to measure sohB protease activity?

Assessing the proteolytic activity of recombinant sohB requires carefully designed experiments that account for its specific characteristics. Several methodological approaches are recommended:

  • Fluorogenic peptide substrates: Using short peptides conjugated to fluorogenic leaving groups that increase fluorescence upon cleavage. This approach requires preliminary identification of preferred cleavage motifs.

  • Pulse-chase experiments: Similar to those described in the literature for tracking the processing of the sohB precursor itself, these can be adapted to monitor the degradation of potential substrate proteins in vivo .

  • In vitro reconstitution: Creating artificial membrane environments (liposomes or nanodiscs) containing purified sohB to assess activity against candidate substrates under controlled conditions.

  • Complementation assays: Leveraging the observed ability of sohB to partially complement htrA/degP mutations when overexpressed to develop genetic screening systems for sohB activity .

Each experimental approach should include appropriate controls:

  • Catalytically inactive sohB mutants (with mutations in predicted active site residues)

  • Protease inhibitor panels to characterize the sensitivity profile

  • Temperature and pH gradients to determine optimal conditions for activity

What is known about the processing and maturation of sohB protein?

Pulse-chase experiments have demonstrated that sohB is synthesized as a precursor protein of approximately 39 kDa that undergoes processing to yield the mature form of approximately 37 kDa . This processing involves the cleavage of an N-terminal signal sequence, predicted to occur between amino acids 22 and 23 based on computer analysis using the PSIGNAL program .

The processing kinetics show rapid conversion from the precursor to the mature form, with significant amounts of mature protein detectable after just 1 minute of chase following a pulse-labeling period . This suggests efficient recognition and processing by the signal peptidase machinery. The processed protein is exported from the cytoplasm to the periplasmic space, where it likely associates with the inner membrane through its central hydrophobic domain (amino acids 190-210) .

Understanding this processing pathway is crucial when designing expression constructs for recombinant production, as the presence or absence of the signal sequence will impact the subcellular localization and possibly the functionality of the expressed protein.

How does overexpression of sohB affect bacterial physiology and stress responses?

Overexpression of the sohB gene has been shown to suppress the temperature-sensitive phenotype observed in bacteria carrying a TnlO insertion in the htrA (degP) gene . This complementation effect occurs when sohB is present on a multicopy plasmid (30-50 copies per cell), suggesting that elevated levels of sohB can partially compensate for the loss of HtrA function .

The HtrA protein is a well-characterized periplasmic protease involved in the degradation of misfolded proteins, particularly under heat stress conditions. The ability of sohB to partially substitute for HtrA suggests that:

  • There may be overlapping substrate specificities between these two proteases

  • SohB might play a secondary or backup role in periplasmic protein quality control

  • Overexpression of sohB could trigger alternative stress response pathways that mitigate the effects of htrA mutation

For researchers studying bacterial stress responses, this relationship provides an opportunity to investigate redundancy and specialization within bacterial protease networks. Comparative transcriptomic and proteomic analyses of wild-type, htrA mutant, and sohB-overexpressing strains under various stress conditions could reveal the broader physiological impacts of modulating these proteases.

What approaches can be used to identify the natural substrates of sohB protease?

Identifying the natural substrates of sohB remains a significant challenge in fully understanding its biological function. Several complementary approaches can be employed:

  • Comparative proteomics: Analyzing the periplasmic proteome of wild-type versus sohB knockout strains, with and without stress conditions, to identify proteins that accumulate in the absence of sohB.

  • Substrate trapping: Engineering catalytically inactive variants of sohB that can bind but not cleave substrates, followed by crosslinking and co-purification to identify trapped proteins.

  • Degradomics: Using techniques such as N-terminomics or TAILS (Terminal Amine Isotopic Labeling of Substrates) to identify protein fragments generated by sohB activity.

  • Genetic interaction screening: Conducting synthetic genetic array analysis to identify genes that exhibit synthetic lethality or synthetic sickness with sohB mutations.

  • In vitro screening: Testing candidate periplasmic proteins for degradation by purified sohB under various conditions.

Each approach has strengths and limitations, and a comprehensive substrate identification strategy would likely combine multiple methods. The identified substrates would provide insights into the biological pathways in which sohB participates and might reveal unexpected functions beyond its presumed role in protein quality control.

How can structural biology approaches enhance our understanding of sohB function?

Advanced structural biology techniques can provide crucial insights into the mechanism and specificity of sohB protease. Several approaches warrant consideration:

  • X-ray crystallography or cryo-EM: Determining the three-dimensional structure of sohB would reveal the arrangement of the catalytic triad, substrate-binding pocket, and membrane interaction domains. This would require generating highly purified, homogeneous protein preparations and potentially removing or replacing the transmembrane domain to enhance crystallization properties.

  • Molecular dynamics simulations: Using computational approaches to model the dynamics of sohB within a membrane environment and predict substrate interactions.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Probing the conformational dynamics and solvent accessibility of different regions of sohB, potentially revealing structural changes associated with substrate binding or membrane association.

  • Site-directed mutagenesis coupled with activity assays: Systematically altering conserved residues to map the functional importance of different protein regions.

  • Cross-linking mass spectrometry: Identifying residues in close proximity within the folded protein and potentially capturing interactions with substrates or cofactors.

The structural data obtained would facilitate comparison with better-characterized proteases such as SppA and HtrA, potentially revealing conserved mechanisms or unique features that explain the specific biological role of sohB.

What are common challenges in working with recombinant sohB and how can they be addressed?

Working with membrane-associated proteases like sohB presents several technical challenges that researchers should anticipate:

ChallengePotential Solutions
Low expression yieldOptimize codon usage for expression host; test different promoter strengths; consider inducible expression systems
Protein insolubilityInclude appropriate detergents in extraction buffers; test mild non-ionic detergents (DDM, CHAPS); consider extracting with different detergent:protein ratios
Loss of activity during purificationMinimize time between lysis and assay; include protease inhibitors (except those targeting serine proteases if measuring activity); maintain consistently cold temperatures
Inconsistent activity assaysStandardize substrate preparation; ensure consistent buffer conditions; include internal controls in each assay
Protein aggregationOptimize buffer composition (ionic strength, pH); include stabilizing agents; consider purifying and storing in smaller aliquots

When working with His-tagged constructs, it's important to verify that the tag doesn't interfere with proper folding or activity. In some cases, comparison between N-terminal and C-terminal tagged versions or inclusion of a cleavable tag may be necessary to ensure that the recombinant protein accurately represents the native form's activity.

How can researchers differentiate between the activities of sohB and other periplasmic proteases?

Distinguishing the specific activity of sohB from other periplasmic proteases requires careful experimental design:

  • Genetic approach: Generate clean knockout strains of sohB and other periplasmic proteases (individually and in combination) to isolate their specific contributions to observed phenotypes or proteolytic activities.

  • Biochemical approach: Utilize protease inhibitors with different specificities to selectively inhibit classes of proteases in activity assays. For example, serine protease inhibitors should affect sohB activity while metalloprotease inhibitors would target different enzymes.

  • Substrate specificity: Develop and validate substrates with preferential cleavage by sohB over other proteases, possibly based on sequence analysis of the regions showing homology with SppA and other related proteases.

  • Antibody-based methods: Generate specific antibodies against sohB for immunodepletion or immunoprecipitation of the protein from complex mixtures prior to activity assays.

  • Expression level manipulation: Use controlled expression systems to vary the levels of sohB independently of other proteases to correlate observed activities with sohB concentration.

What controls should be included when studying functional complementation between sohB and htrA?

When investigating the observed functional complementation between sohB and htrA, several essential controls should be included:

  • Expression level verification: Quantify the expression levels of sohB in complementation experiments using western blot or qPCR to ensure consistent overexpression across experimental replicates.

  • Inactive sohB mutant: Include a catalytically inactive version of sohB (with mutations in predicted active site residues) to determine whether proteolytic activity is required for complementation or if the effect is mediated by another mechanism (e.g., chaperone-like activity).

  • Domain swapping constructs: Create chimeric proteins containing domains from both sohB and htrA to identify which regions are responsible for the overlapping functionality.

  • Stress condition panel: Test complementation under various stress conditions (temperature, oxidative stress, envelope stress) to characterize the spectrum of conditions under which sohB can substitute for htrA.

  • Substrate accumulation analysis: Monitor the accumulation of known htrA substrates in wild-type, htrA mutant, and sohB-overexpressing strains to determine if sohB directly processes htrA substrates or acts through an alternative pathway.

These controls will help differentiate between direct functional replacement and indirect suppression mechanisms, providing deeper insights into the relationship between these periplasmic proteases and their roles in bacterial physiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.