Recombinant Haemophilus influenzae Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Molecular Function and Biological Role

LGT catalyzes the transfer of an sn-1,2-diacylglyceryl group from phosphatidylglycerol to the cysteine residue of prolipoproteins, forming a thioether bond. This initial step in lipoprotein maturation is conserved across bacteria, including H. influenzae, and is vital for:

  • Membrane localization of lipoproteins

  • Structural integrity of bacterial cell envelopes

  • Pathogenicity via surface-exposed virulence factors

Functional Insights from Mutagenesis and Inhibition

  • Mutant alleles: Single-amino-acid substitutions (e.g., G104S, W25R) in LGT disrupt diacylglyceryl transfer, impairing bacterial growth and virulence .

  • Chemical inhibition: Diethylpyrocarbonate (DEPC) inactivates E. coli LGT with a second-order rate constant of 18.6 M⁻¹s⁻¹, implicating histidine residues in catalysis .

  • Reversibility: Hydroxylamine restores activity after DEPC treatment, confirming reversible modification of catalytic residues .

Recombinant LGT in Vaccine Development

Recombinant LGT is produced in heterologous systems (e.g., E. coli, yeast) for antigenic and functional studies. Key applications include:

Table 2: Recombinant LGT Products and Applications

Product (Source)StrainPurityApplication
Recombinant LGT 86-028NP>90%Vaccine antigen screening
Lipidated OMP26 Fusion constructs>95%TLR2/6 activation studies
XerC recombinase 86-028NP>85%DNA recombination assays
  • Lipidation-enhanced immunogenicity: Lipidated LGT fusion proteins (e.g., L-OMP26φNL-P6) stimulate stronger TLR2-dependent immune responses than nonlipidated forms, enhancing IgG and IgA production in murine models .

  • Cross-species utility: H. influenzae LGT shares functional homology with S. aureus and E. coli enzymes, enabling comparative studies on antibiotic targets .

Clinical and Epidemiological Relevance

  • Pathogenesis: Non-typeable H. influenzae (NTHi) relies on lipoprotein variation for immune evasion, driven by recombination in LPS biosynthesis genes .

  • Vaccine challenges: Despite Hib vaccine success, NTHi remains a global burden due to high recombination rates and emerging multidrug resistance .

  • Therapeutic potential: Targeting LGT could disrupt lipoprotein maturation, offering a novel antibacterial strategy .

Research Gaps and Future Directions

  • Structural resolution: Cryo-EM or crystallographic data for H. influenzae LGT remains limited.

  • In vivo validation: Efficacy of LGT inhibitors in animal models of NTHi infection is underexplored.

  • Pan-bacterial targeting: Conserved LGT motifs may enable broad-spectrum inhibitors against gram-negative and gram-positive pathogens .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery information.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipment is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; CGSHiEE_07495; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-268
Protein Length
full length protein
Species
Haemophilus influenzae (strain PittEE)
Target Names
lgt
Target Protein Sequence
MNSNYLLLPHFDPSIFTLGDSNIGLRWYGLMYLLGFVFARWLAVRRANRPNSGWTVDQVD SLLFNGFMGVFIGGRVGDVFFYNLDHFLQEPLYLFRVWEGGMSFHGGLIGVIVAMIWTSY SQKRNFWQTADFVAPLIPFGLGLGRIGNFINLELWGRETNVPWAMIFPNDPLLLPRHPSQ LYEAFLEGLVLFAILNIFIKKPRPMASVAGLFLIGYGVFRFIVEYVREPEVENFFGIITR GQALCLPMIIGGAFIMAWAYSRKSAVIK
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein, marking the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein diacylglyceryl transferase (Lgt) and what is its function in bacteria?

Prolipoprotein diacylglyceryl transferase (Lgt) is an essential enzyme that catalyzes the first and committed step in the post-translational lipoprotein modification pathway in bacteria. This enzyme transfers a diacylglyceryl moiety to prelipoproteins, which is crucial for proper localization and function of lipoproteins in the bacterial cell envelope. Lipoproteins themselves are important components of the bacterial cell envelope, which is an excellent target for antibiotics . In Haemophilus influenzae, Lgt is encoded by the lgt gene (locus HI_0904) and produces a protein with EC classification 2.4.99.- .

What are the storage and handling recommendations for recombinant H. influenzae Lgt?

Recombinant H. influenzae Lgt should be stored in a Tris-based buffer containing 50% glycerol, which is optimized for protein stability. For routine storage, maintain the protein at -20°C. For extended storage periods, it is recommended to store the protein at either -20°C or -80°C. Importantly, repeated freezing and thawing cycles should be avoided as they can compromise protein integrity and activity. Working aliquots can be stored at 4°C for up to one week to minimize freeze-thaw damage .

How conserved is Lgt across bacterial species?

Evolutionary and phylogenomic analyses reveal that Lgt is present in all bacteria, including those lacking a peptidoglycan cell wall, but is notably absent from archaea. A comprehensive database search identified 14,664 hits in 12,956 out of 13,512 different genomes, demonstrating the ubiquitous nature of this enzyme in bacteria . Approximately 1,300 bacterial genomes contain two lgt genes, and fewer than 200 have up to four copies. Comparative sequence analysis between S. aureus and E. coli Lgt shows 24% identity and 47% similarity, despite S. aureus Lgt being 12 amino acids shorter than its E. coli counterpart .

What structural features characterize Lgt, and how do they differ between bacterial species?

Recent structural analyses using AlphaFold models compared with X-ray crystallography data from E. coli Lgt reveal that while the core transmembrane structure is conserved, significant variability exists in the arm and head domains. The protein contains seven transmembrane segments with functionally important regions . The most striking structural differences are observed in the periplasmic (head) domain – Enterobacteriales and β-proteobacteria possess similarly large head domains, whereas more distantly related proteobacteria and firmicutes have smaller, less prominent head domains that are predicted to be located closer to the membrane interface .

The X-ray structure of E. coli Lgt shows an α-helix that arcs below the membrane plane, while AlphaFold models predict a shortened α-helix with an unstructured loop extending upwards through the membrane. Additional structural variations are observed in the L6-7 region and in the loop between arm-2 and TM-3 .

What conserved motifs and essential residues are critical for Lgt function?

Multiple sequence alignment and mutagenesis studies have identified several essential residues in Lgt. The following table summarizes key residues that are critical for enzyme function:

Conserved ResidueLocationEffect of Mutation
Y26Transmembrane segment 1 (TM-1)Y26A mutation prevents growth restoration
H103-GGLIG-108Highly conserved motifH103Q causes limited growth and cell lysis; G104S results in temperature sensitivity
R143Transmembrane segment 4 (TM-4)R143A prevents growth restoration
N146Transmembrane segment 4 (TM-4)N146A prevents growth restoration
G154Loop between TM-4 and head domainG154A prevents growth restoration
R239Transmembrane segment 6 (TM-6)R239A prevents growth restoration

The motif H-103-GGLIG-108 represents the longest set of identical amino acids without any gap across multiple bacterial species, highlighting its functional importance .

How can chemical modification studies inform our understanding of the Lgt catalytic mechanism?

Chemical modification studies provide valuable insights into catalytically important residues in Lgt. Treatment of E. coli Lgt with diethylpyrocarbonate results in enzyme inactivation with a second-order rate constant of 18.6 M⁻¹s⁻¹. Importantly, this inactivation is reversible by hydroxylamine treatment at pH 7, consistent with modification of either a histidine or tyrosine residue that is essential for catalytic activity .

The inactivation kinetics suggest modification of a single residue critical for enzyme function. When combined with mutagenesis data identifying H103 and Y26 as essential residues, these chemical modification studies provide strong evidence for the involvement of these residues in the catalytic mechanism of Lgt .

What experimental approaches can be used to assess Lgt function across different bacterial species?

Functional assessment of Lgt from different bacterial species typically involves complementation studies using E. coli strains with either temperature-sensitive lgt mutations or controlled depletion of endogenous Lgt. Key experimental approaches include:

  • Temperature-sensitive mutant complementation: Using strains like E. coli SK634, which contains a temperature-sensitive lgt mutation (G104S), researchers can test whether heterologous Lgt proteins can restore growth at non-permissive temperatures .

  • Depletion strain complementation: Utilizing strains where chromosomal lgt is deleted and complemented with a plasmid-borne copy under an inducible promoter. Growth restoration, colony formation, and cell morphology are assessed .

  • Double mutant systems: The use of ΔlgtΔlpp strains prevents toxicity caused by accumulation of unmodified Braun's lipoprotein (Lpp), allowing more sensitive detection of partial Lgt function .

  • In vitro enzymatic assays: Direct measurement of prolipoprotein diacylglyceryl modification activity using purified enzymes and substrate analogs .

Using these approaches, researchers have determined that Lgt proteins from proteobacteria, but not from firmicutes, can restore growth and viability in E. coli Lgt depletion strains, revealing functional differences that correlate with structural variations in the arm and head domains .

How does the periplasmic head domain influence Lgt functionality?

The periplasmic head domain shows significant variability across bacterial species and plays a crucial role in Lgt function. Complementation experiments with chimeric proteins reveal that exchanging the head domain of E. coli Lgt with those from different bacterial species affects enzyme functionality. For example, Lgt with a head domain from Mycobacterium tuberculosis (Lgt-HeadMt) fails to support colony formation in Δlgt strains, although it permits growth to mid-exponential phase in ΔlgtΔlpp backgrounds before cell filamentation and lysis occur .

Similarly, Lgt with a head domain from S. aureus (Lgt-HeadSa) does not completely restore viability in Δlgt strains and forms only small colonies on glucose IPTG plates in ΔlgtΔlpp backgrounds. These results strongly suggest that the periplasmic head domain, despite its variability across species, is essential for proper Lgt function and cannot be freely exchanged between distant bacterial species .

What is the potential of H. influenzae Lgt as an antibiotic target?

H. influenzae Lgt represents a promising target for novel antibiotic development due to several key characteristics:

  • Essentiality: Lgt is essential for cell viability in proteobacteria, including H. influenzae .

  • Membrane localization: As a membrane protein, Lgt has domains that are potentially accessible to inhibitors .

  • Conservation of essential residues: Critical catalytic residues like those in the H-103-GGLIG-108 motif are highly conserved across bacterial species .

  • Absence in eukaryotes: The bacterial lipoprotein modification pathway is absent in humans, reducing the risk of target-based toxicity.

  • Structural data availability: Recent advances in structural biology, including AlphaFold models and X-ray crystallography data from homologous proteins, provide templates for structure-based drug design .

Development of inhibitors targeting conserved catalytic residues could potentially yield broad-spectrum antibiotics, while those exploiting differences in the arm and head domains might lead to narrow-spectrum agents specific for certain bacterial groups .

How do Lgt proteins from different bacteria compare in terms of sequence and structure?

Comparative analysis of Lgt proteins from different bacterial species reveals both conserved features and significant variations:

SpeciesAmino Acid LengthMolecular WeightSequence Identity to E. coli LgtNotable Features
H. influenzae268Not specifiedNot specified directlyUniProt: P44930, Locus: HI_0904
S. aureus27931.6 kDa24% identity, 47% similarity12 amino acids shorter than E. coli, similar hydropathic profile and pI (10.4)
E. coli~291 (inferred)Not specified100% (reference)7 transmembrane segments, well-characterized essential residues
S. typhimuriumNot specifiedNot specifiedSimilar to E. coliFunctionally similar to E. coli Lgt

What methodological approaches are optimal for studying structure-function relationships in Lgt?

To thoroughly investigate structure-function relationships in Lgt proteins from different bacterial species, researchers should consider a multi-faceted approach:

  • Sequence analysis and conservation mapping: Identifying conserved residues across phylogenetically diverse bacteria can highlight functionally critical regions.

  • Mutagenesis studies: Site-directed mutagenesis of conserved residues, followed by functional complementation assays, can define essential amino acids .

  • Protein chimeras: Creating chimeric proteins by exchanging domains between Lgt from different species helps determine the functional importance of specific regions, as demonstrated with the head domain studies .

  • Chemical modification: Specific chemical modifications combined with activity assays can identify catalytically important residues and their chemical properties .

  • Structural biology: X-ray crystallography and cryo-EM studies, complemented by computational modeling (e.g., AlphaFold), provide insights into the three-dimensional architecture and potential mechanism .

  • In vitro enzymatic assays: Developing robust assays for measuring Lgt activity with defined substrates allows quantitative assessment of wildtype and mutant enzymes.

This integrated approach has successfully identified critical residues like Y26, H103, R143, N146, G154, and R239, as well as important structural elements including the arm and head domains .

What are promising strategies for developing inhibitors against H. influenzae Lgt?

Based on current structural and functional knowledge of Lgt, several strategies show promise for inhibitor development:

  • Targeting conserved catalytic residues: Focusing on the highly conserved H-103-GGLIG-108 motif and other essential residues (Y26, R143, N146, G154, R239) could yield broad-spectrum inhibitors .

  • Structure-based design: Using AlphaFold models and available X-ray structures to design compounds that interfere with substrate binding or catalysis .

  • Species-specific inhibitors: Exploiting differences in the arm and head domains between bacterial groups could lead to narrow-spectrum agents with reduced impact on the microbiome .

  • Transition state analogs: Designing compounds that mimic the transition state of the diacylglyceryl transfer reaction could provide potent and specific inhibitors.

  • Allosteric inhibitors: Targeting non-catalytic regions that affect protein conformation or membrane integration, potentially disrupting Lgt function through indirect mechanisms.

The essential nature of Lgt in proteobacteria and its membrane accessibility make it a particularly attractive target for antibiotic development against H. influenzae and other pathogenic bacteria .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.