Recombinant Haemophilus influenzae Protease HtpX (htpX)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant HtpX refers to the H. influenzae HtpX protein produced heterologously in expression systems such as Escherichia coli, yeast, or mammalian cells. HtpX is a membrane-bound zinc metalloprotease hypothesized to participate in proteolytic regulation of membrane proteins under stress conditions, analogous to its homologs in other bacteria .

  • Gene and Protein Structure:

    • The htpX gene encodes a 283-amino-acid protein (strain PittEE) with a predicted molecular weight of ~32 kDa .

    • Structural homology modeling suggests conserved domains, including a zinc-binding motif (HEXXH) critical for catalytic activity .

Proteolytic Activity

HtpX exhibits zinc-dependent endoprotease activity, targeting misfolded membrane proteins. Key findings from homologous systems (E. coli) include:

PropertyDetails
Catalytic MechanismZinc-dependent cleavage of peptide bonds; requires Zn²⁺ for activation .
SubstratesDegrades casein and membrane proteins (e.g., SecY) .
AutoproteolysisSelf-cleavage occurs upon solubilization or zinc chelation .
ThermostabilityRetains activity under thermal stress, aligning with its stress-response role .

Vaccine Development

Recombinant HtpX is being explored as a vaccine antigen due to its surface exposure and conservation across H. influenzae strains .

ApplicationFindings
ImmunogenicityElicits robust antibody responses in preclinical models .
Protection StudiesPartial efficacy observed in animal models of bacteremia and otitis media .

Functional Studies

  • Stress Response: HtpX is upregulated under thermal stress, suggesting a role in mitigating protein misfolding .

  • Pathogenesis: Potential involvement in biofilm formation or immune evasion, though direct evidence in H. influenzae remains limited .

Expression Systems

Recombinant HtpX is produced in:

  1. E. coli (most common, cost-effective) .

  2. Yeast or mammalian cells (for post-translational modifications) .

Purification Challenges

  • Solubility: Requires refolding from denatured states due to membrane localization .

  • Stability: Susceptible to autodegradation unless stabilized with zinc chelators .

Knowledge Gaps and Future Directions

  • Substrate Specificity: Limited data exist on H. influenzae HtpX substrates compared to E. coli homologs .

  • Structural Data: No crystal structures are available for H. influenzae HtpX; homology models rely on E. coli templates .

  • Therapeutic Potential: Further studies are needed to validate its efficacy as a vaccine candidate or antimicrobial target .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type preference, please inform us, and we will prioritize developing it accordingly.
Synonyms
htpX; CGSHiGG_06915; Protease HtpX; Heat shock protein HtpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-283
Protein Length
full length protein
Species
Haemophilus influenzae (strain PittGG)
Target Names
htpX
Target Protein Sequence
MMRILLFLATNMAVMLVLGIILSVTGIAGNSTGGILIMALLFGFAGSLISLFLSKTMALR SVDGEVITQPRNQTERWLIDTVSRQAQKAGIPMPDVAIYHSPDVNAFATGATKSNSLVAV STGLLNNMTEAEAEAVLAHEISHISNGDMVTMALLQGVLNTFVIFLSRVIATAVASSRNN NGEETRSSGIYFLVSMVLEMLFGVLASIIAMWFSRYREFRADAGSASLVGKEKMIMALQR LQQLHEPQNLEGSLNAFMINGKRSELFMSHPPLEKRIEALRNL
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does HtpX differ from other Haemophilus influenzae proteases like HtrA?

HtpX and HtrA represent different protease families with distinct catalytic mechanisms:

FeatureHtpXHtrA
Enzyme typeZinc metalloproteinaseSerine protease
FamilyM48 familyHtrA/DegP family
Catalytic residuesHEXXH motif (zinc coordination)Catalytic triad (Ser, His, Asp)
Cellular locationIntegral membrane proteinAssociated with membrane
Temperature responseExpression inducible by high temperatureExpression inducible by high temperature
Protective propertiesNot yet established for H. influenzaeDemonstrated protective antigen
Mutation strategyE140A (catalytically ablated form)H91A (catalytically ablated form)

HtrA from H. influenzae has been extensively characterized and shown to have serine protease activity. The recombinant protein is highly immunogenic and demonstrates protective properties in animal models of bacteremia and otitis media .

What conserved domains and catalytic residues are essential for HtpX function?

Based on studies of HtpX in E. coli, the protein contains a critical HEXXH motif common to zinc metalloproteinases, with the glutamic acid residue (E140) being essential for catalytic activity. Site-directed mutagenesis studies have demonstrated that replacing this glutamic acid with alanine (E140A) effectively ablates protease activity while maintaining proper protein folding . This mutation strategy is particularly useful for structural studies as it prevents self-cleavage at high protein concentrations required for crystallization. The zinc coordination within the active site is crucial for maintaining the correct active-site architecture .

What expression systems are most effective for producing recombinant H. influenzae HtpX?

While specific expression protocols for H. influenzae HtpX are not detailed in the search results, successful approaches for homologous proteins provide valuable guidance:

  • E. coli expression system: E. coli has been successfully used to express recombinant membrane proteases, including HtpX from E. coli itself . The pET28 vector system with modifications has proven effective for expression of membrane proteases.

  • Tagging strategies: C-terminal tags such as His6 or His8 tags facilitate purification while minimizing interference with membrane insertion. For example, successful expression has been achieved using:

    • 4-kDa C-terminal tag comprising a factor Xa peptidase recognition site and a hexahistidine tag

    • 2-kDa C-terminal tag comprising a factor Xa peptidase recognition site and an octahistidine tag

  • Strain selection: Various E. coli strains should be screened for optimal expression of the membrane protease.

What are the most effective methods for purifying recombinant HtpX while maintaining its native conformation?

For membrane proteases like HtpX, maintaining the native conformation during purification is critical. Based on successful approaches with E. coli HtpX:

  • Membrane extraction method: Rather than using denaturing agents and refolding from inclusion bodies, a more effective approach involves extracting the protein directly from membranes using detergents. This method has been shown to yield well-folded, catalytically active protein .

  • Catalytic ablation strategy: For structural studies requiring high protein concentrations, using a catalytically inactive mutant (E140A) prevents self-cleavage while maintaining proper folding .

  • Activity verification: The wild-type protein should undergo self-cleavage during purification, indicating catalytic activity and proper folding. This serves as an important quality control checkpoint .

How can researchers assess the quality and activity of purified recombinant HtpX?

Several approaches can be employed to verify the quality and activity of purified recombinant HtpX:

  • Self-cleavage assay: Wild-type HtpX undergoes self-cleavage during purification, which serves as an indicator of proper folding and catalytic activity .

  • Model substrate assays: Similar to approaches developed for E. coli HtpX, model substrates can be constructed to establish in vivo semiquantitative and convenient protease activity assay systems . These systems can detect differential protease activities of HtpX mutants carrying mutations in conserved regions.

  • Structural integrity assessment: Techniques such as circular dichroism spectroscopy can be used to assess the secondary structure content of the purified protein.

How can site-directed mutagenesis be used to study HtpX structure-function relationships?

Site-directed mutagenesis is a powerful approach for investigating the structure-function relationships of HtpX:

  • Catalytic residue mutation: The glutamic acid in the HEXXH motif (E140 in E. coli HtpX) can be replaced with alanine to create a catalytically inactive variant suitable for structural studies . This approach prevents self-cleavage while maintaining proper protein folding.

  • Transmembrane domain analysis: Mutations in the hydrophobic regions (H1-H4) can help determine their role in membrane integration and protein function .

  • Zinc coordination studies: Mutations affecting residues involved in zinc coordination can provide insights into the metal-binding properties of HtpX.

This approach parallels successful studies with H. influenzae HtrA, where site-directed mutagenesis was performed to ablate the endogenous serine protease activity, resulting in mutant proteins with no measurable residual proteolytic activity .

What model substrates and assay systems can be developed to study HtpX activity?

Based on successful approaches with E. coli HtpX:

  • Engineered model substrates: Researchers have constructed model substrates specifically designed for HtpX, enabling the establishment of in vivo semiquantitative and convenient protease activity assay systems .

  • GFP-based reporter systems: Modified green fluorescent protein (GFP) constructs, particularly monomeric superfolder GFP (msfGFP), can be engineered as reporter substrates to visualize protease activity .

  • Cleavage fragment analysis: The full-length product (XMS1-FL) and cleaved fragments (CL-C and CL-N) can be analyzed to assess protease activity .

These systems enable detection of differential protease activities between wild-type enzymes and variants with mutations in conserved regions, providing valuable tools for structure-function studies.

What potential applications exist for recombinant H. influenzae HtpX in vaccine development?

While specific vaccine applications for HtpX from H. influenzae are not directly addressed in the search results, insights can be drawn from research on other H. influenzae proteases:

  • Protective antigen potential: The H. influenzae HtrA protein has been shown to be a protective antigen, demonstrating partial protection in both the passive infant rat model of bacteremia and the active chinchilla model of otitis media . If HtpX shares immunogenic properties, it might similarly serve as a vaccine candidate.

  • Catalytically inactive variants: Studies with HtrA demonstrated that certain catalytically inactive mutants, particularly H91A, retained protective properties in animal models . Similar approaches could be explored with HtpX, developing catalytically inactive variants that maintain immunogenicity while eliminating potential adverse effects of protease activity.

  • Conservation assessment: HtrA was found to be antigenically conserved across encapsulated and nontypeable H. influenzae species . Evaluating the conservation of HtpX across different H. influenzae strains would be an important step in assessing its vaccine potential.

What animal models are suitable for studying the role of HtpX in H. influenzae infection?

Based on successful models used for studying H. influenzae proteases:

  • Infant rat model of bacteremia: This passive protection model has been effective for evaluating the protective effects of H. influenzae proteins, including HtrA .

  • Chinchilla model of otitis media: This active immunization model provides valuable insights into the role of bacterial proteins in middle ear infections caused by H. influenzae .

  • Human lung epithelial cell culture models: In vitro models using human lung carcinoma cells (A549) have been used to study H. influenzae adherence mechanisms involving bacterial proteases .

These models could be adapted to investigate the specific role of HtpX in H. influenzae pathogenesis and potential protective effects of recombinant HtpX proteins.

How does environmental stress affect HtpX expression and activity?

Based on studies of HtpX and similar proteases in various bacterial species:

  • Temperature stress response: Expression of the H. influenzae htrA gene was found to be inducible by high temperature . HtpX likely shows similar temperature-dependent regulation, as observed in other bacterial species.

  • Misfolded protein accumulation: Studies in other bacteria have demonstrated that htpX plays a role in the general stress response of the cell and is up-regulated by the accumulation of misfolded proteins .

  • Metal exposure response: In contrast to some stress-responsive genes, htpX in P. aeruginosa was not found to be up-regulated by exposure to different metals, suggesting potential specificity in its stress response pathway .

Understanding these regulatory patterns is crucial for optimizing experimental conditions when working with recombinant HtpX.

What analytical techniques are most informative for characterizing the structural properties of recombinant HtpX?

For comprehensive structural characterization of recombinant HtpX:

  • X-ray crystallography: Using catalytically inactive mutants (e.g., E140A) can prevent self-cleavage at high protein concentrations required for crystallization, enabling structural studies .

  • Membrane protein topology analysis: Techniques to determine the orientation and membrane insertion of the four hydrophobic regions (H1-H4), resolving controversies about whether the C-terminal regions are embedded in the membrane .

  • Zinc coordination analysis: Spectroscopic techniques to characterize the zinc-binding properties and metal coordination geometry in the active site.

  • Protease activity assays: In vivo semiquantitative assays using model substrates provide functional validation of structural integrity .

How can researchers overcome challenges associated with membrane protein expression and purification?

Membrane proteins like HtpX present specific challenges that can be addressed through several strategies:

  • Detergent extraction approach: Instead of denaturing conditions and refolding from inclusion bodies, direct extraction from membranes using appropriate detergents has proven effective for maintaining native-like conformations of HtpX .

  • Expression optimization: Screening multiple E. coli strains and expression conditions (temperature, induction parameters) can significantly improve yield and quality of recombinant membrane proteins.

  • Fusion tag strategies: Carefully designed C-terminal tags that facilitate purification while minimizing interference with membrane insertion and folding.

  • Catalytically inactive variants: For structural studies requiring high protein concentrations, using catalytically inactive mutants (E.g., E140A for HtpX) prevents self-cleavage while maintaining proper folding .

What are the knowledge gaps in our understanding of H. influenzae HtpX compared to homologous proteins in other bacteria?

Several important knowledge gaps exist:

  • Specific substrates in H. influenzae: While HtpX is known to be involved in quality control of membrane proteins in E. coli, the specific physiological substrates in H. influenzae remain to be identified.

  • Role in pathogenesis: Unlike HtrA, which has been characterized as a protective antigen , the potential role of HtpX in H. influenzae virulence and host-pathogen interactions remains largely unexplored.

  • Regulatory networks: The specific regulatory mechanisms controlling htpX expression in H. influenzae under various stress conditions require further investigation.

  • Structural details: High-resolution structural information for H. influenzae HtpX is currently lacking, limiting our understanding of its specific catalytic mechanisms and substrate recognition.

How might comparative studies between HtpX and other bacterial proteases advance our understanding of membrane protein quality control systems?

Comparative studies offer valuable opportunities for advancing our understanding:

  • Cross-species functional conservation: Studies comparing HtpX function across H. influenzae, E. coli, and P. aeruginosa could reveal conserved and species-specific aspects of membrane protein quality control .

  • Complementary protease systems: Investigating the functional relationships between HtpX and other proteases (e.g., HtrA) could provide insights into how these systems work together to maintain membrane homeostasis.

  • Evolution of stress response mechanisms: Comparing the regulation and substrate specificity of HtpX across different bacterial species could illuminate the evolution of stress response mechanisms.

  • Therapeutic target assessment: Comparative analysis of the essentiality and drug-targeting potential of HtpX across pathogenic bacteria could inform antimicrobial development strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.