Recombinant Haemophilus influenzae Protein CrcB homolog (crcB)

What is the Recombinant Haemophilus influenzae Protein CrcB homolog?

The Recombinant Haemophilus influenzae Protein CrcB homolog is a full-length protein derived from Haemophilus influenzae strain PittEE. It has UniProt accession number A5UEC3 and is encoded by the crcB gene (locus name: CGSHiEE_09165). The protein consists of 128 amino acids with the sequence: MQALLFISCGAILGASLRWAIGLLFNPLFSSFAFGALIANLLGCLIIGVLLGLFWQFPQISAEWRLFLITGFLGSLTTFSSFSSEVVELFFNDKWLNGFCVLMMHLFGCLAMTVLGIWIYKICSQLLS . Based on homology to other bacterial CrcB proteins, it likely functions as a fluoride ion channel component, providing resistance to fluoride toxicity, though specific functional studies in H. influenzae are needed for confirmation.

How should Recombinant CrcB homolog protein be stored for optimal stability?

For optimal stability of the Recombinant Haemophilus influenzae Protein CrcB homolog, the protein should be stored at -20°C in its supplied buffer (typically Tris-based buffer with 50% glycerol) . For extended storage periods, -80°C is recommended. Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they may compromise protein integrity . To minimize degradation during experimental procedures, researchers should thaw aliquots on ice and return unused portions to appropriate storage conditions promptly after use. Storage buffer optimization may be necessary depending on downstream applications, particularly for structural studies or activity assays.

What are the structural characteristics of the CrcB homolog protein?

The Haemophilus influenzae CrcB homolog protein (UniProt: A5UEC3) is a 128-amino acid transmembrane protein . Based on the amino acid sequence analysis and comparison with other bacterial CrcB proteins, it likely contains multiple transmembrane domains with hydrophobic regions (as evident from the amino acid sequence containing stretches of hydrophobic residues like LFNPLFSSFAFGALIANLLGCLIIGVLLGL) . The protein likely adopts a membrane-spanning confirmation with both N-terminal and C-terminal regions. While crystal structures of H. influenzae CrcB are not available from the search results, homology modeling based on related bacterial channel proteins would predict a dimeric or trimeric assembly forming a channel through the membrane. Biophysical characterization techniques such as circular dichroism spectroscopy would be valuable for determining secondary structure elements, while techniques like size exclusion chromatography could help determine its oligomeric state.

What expression systems are recommended for producing Recombinant H. influenzae CrcB homolog?

The expression of Recombinant H. influenzae CrcB homolog can be achieved using several expression systems, with E. coli being the most commonly employed due to its simplicity and cost-effectiveness. For membrane proteins like CrcB, specialized E. coli strains such as C41(DE3) or C43(DE3) designed for membrane protein expression are recommended. Based on standard practices for similar bacterial proteins, expression should involve optimization of induction conditions (IPTG concentration, temperature, and duration) . For challenging expression, alternative systems like yeast (P. pastoris), baculovirus-infected insect cells, or mammalian cell expression systems may be considered, especially when proper folding or post-translational modifications are critical . The choice of expression system should align with downstream applications, with bacterial systems sufficient for antibody production but eukaryotic systems potentially better for functional studies requiring native conformation.

How does the CrcB homolog from H. influenzae compare functionally with CrcB homologs from other bacterial species?

The CrcB homolog from Haemophilus influenzae likely shares core functional characteristics with other bacterial CrcB proteins, including its role in fluoride ion efflux. While the search results don't provide direct functional comparison data, phylogenetic analysis approaches similar to those used for other H. influenzae proteins would be valuable. H. influenzae, as a relatively ancient organism, may possess a CrcB variant with ancestral features that could provide insights into the evolutionary development of fluoride resistance mechanisms. Researchers should design comparative functional assays measuring fluoride resistance in various bacterial backgrounds complemented with the H. influenzae CrcB. Unlike the extensively studied multidrug efflux pump AcrB from H. influenzae, which despite its ancestral nature maintains similar substrate specificity to its E. coli counterpart , the CrcB homolog may exhibit unique properties reflecting its adaptation to the upper respiratory tract environment where H. influenzae naturally resides .

What methods are most effective for studying the interaction between CrcB homolog and potential binding partners?

For investigating interactions between H. influenzae CrcB homolog and potential binding partners, researchers should employ a multi-faceted approach. Pull-down assays using tagged recombinant CrcB protein can identify interacting proteins in H. influenzae lysates. For membrane protein interactions, techniques like crosslinking followed by mass spectrometry are particularly valuable. Bacterial two-hybrid systems adapted for membrane proteins offer another approach for validation of specific interactions. For real-time interaction kinetics, surface plasmon resonance (SPR) or bio-layer interferometry with purified components provides quantitative binding parameters. Computational approaches including molecular docking can predict interactions with small molecules or ions. When expressing CrcB in heterologous systems for interaction studies, researchers should consider using conjugal expression systems as described for other H. influenzae proteins , which provide advantages for difficult-to-transform clinical isolates. Co-immunoprecipitation experiments in the native H. influenzae background would provide the most physiologically relevant interaction data.

How might post-translational modifications affect the function of the CrcB homolog in H. influenzae?

While bacterial proteins typically undergo fewer post-translational modifications (PTMs) than eukaryotic proteins, several PTMs could potentially affect H. influenzae CrcB homolog function. Phosphorylation, particularly of serine, threonine, or tyrosine residues in cytoplasmic loops, could regulate channel opening or closing, similar to other bacterial ion channels. Methylation or acetylation could influence protein-protein interactions or membrane localization. To investigate PTMs, researchers should employ mass spectrometry-based proteomics approaches, comparing CrcB from different growth conditions to identify condition-dependent modifications. Mutational analysis of predicted modification sites (creating phosphomimetic mutations like S→D or phosphodeficient mutations like S→A) can help establish the functional significance of identified PTMs. Challenging experiments would include in vitro reconstitution of the modification system with purified kinases or other modifying enzymes. The relationship between any identified PTMs and physiological responses to environmental stress, particularly fluoride exposure, would be particularly valuable to examine in H. influenzae, given its adaptation to the human respiratory tract environment .

What is the relationship between CrcB homolog function and antimicrobial resistance in clinical isolates of H. influenzae?

The relationship between CrcB homolog function and antimicrobial resistance in H. influenzae clinical isolates represents a critical research area, especially considering H. influenzae's role in respiratory infections . While CrcB primarily functions as a fluoride channel, potential interactions with antibiotic resistance mechanisms should be investigated through several approaches. Researchers should sequence the crcB gene from diverse clinical isolates with varying antibiotic resistance profiles to identify correlations between sequence variations and resistance patterns. Gene knockout and complementation studies would establish whether CrcB contributes to intrinsic resistance to certain antibiotics, particularly those with fluoride atoms or charged molecules. Fluoride channel activity could potentially influence membrane potential or proton gradients, indirectly affecting other resistance mechanisms like efflux pumps. Unlike the well-characterized AcrB efflux pump in H. influenzae that directly contributes to β-lactam resistance , CrcB's contribution might be more subtle and condition-dependent. Comparison between nontypeable and encapsulated H. influenzae strains would be valuable, as these show different infection patterns and potentially different resistance mechanisms .

What are the optimal conditions for purifying functional Recombinant CrcB homolog protein?

Purification of functional Recombinant CrcB homolog requires a carefully optimized protocol due to its nature as a membrane protein. After expression (ideally using an E. coli or other suitable system ), cells should be lysed under gentle conditions to preserve protein structure. The purification workflow should include:

• Membrane fraction isolation through differential centrifugation (40,000-100,000×g)

• Solubilization using appropriate detergents (initial screening recommended among DDM, LMNG, or CHAPS)

• Immobilized metal affinity chromatography (IMAC) using the histidine tag typically incorporated in recombinant constructs

• Size exclusion chromatography for final purification and buffer exchange

Throughout purification, buffer conditions should be optimized for pH (typically 7.0-8.0) and salt concentration (150-300 mM NaCl). The addition of glycerol (10-20%) and reducing agents can enhance stability. For functional studies, reconstitution into liposomes or nanodiscs may be necessary to maintain native conformation. Quality control should include SDS-PAGE, Western blotting, and if possible, activity assays measuring fluoride transport. Yields are typically lower for membrane proteins than soluble proteins, often in the range of 0.1-1 mg per liter of culture.

How can researchers effectively generate antibodies against the CrcB homolog?

Generating specific antibodies against H. influenzae CrcB homolog requires strategic approaches due to challenges associated with membrane proteins. Researchers should:

• Identify antigenic epitopes through computational prediction, prioritizing hydrophilic regions likely exposed at the protein surface

• Generate multiple immunogens including:

  • Synthetic peptides corresponding to predicted extracellular/cytoplasmic loops

  • Recombinant fusion proteins incorporating soluble tags (MBP, GST)

  • Full-length protein in detergent micelles

For immunization protocols, researchers should consider using multiple animal species (rabbits and mice) to increase chances of successful antibody generation. A prime-boost strategy with different immunogen forms often yields better results. For antibody screening and validation, researchers should implement multiple methods:

• ELISA against the immunizing antigen

• Western blotting against recombinant protein and H. influenzae lysates

• Immunofluorescence microscopy to confirm localization

• Specificity validation using crcB knockout strains

Monoclonal antibodies offer advantages in specificity but may be more challenging to generate against membrane proteins like CrcB. Commercial antibody production services may be valuable for researchers without extensive immunology expertise.

What expression vector systems are most suitable for studying CrcB homolog in H. influenzae?

For studying CrcB homolog in H. influenzae, researchers face challenges due to the difficulty in transforming many clinical isolates. Based on available information, a conjugal expression system represents the most effective approach . This system involves:

• Construction of broad-host-range vectors containing:

  • The crcB gene under control of an appropriate promoter

  • Antibiotic resistance markers (likely chloramphenicol or kanamycin)

  • Origins of replication functional in H. influenzae

• Transfer of the construct via intergeneric conjugation using E. coli strains with chromosomally-encoded transfer functions

This approach circumvents the low transformation efficiency of H. influenzae, particularly nontypeable strains . For functional studies, researchers should consider inducible promoters to control expression levels, and incorporation of epitope or fluorescent tags for protein detection and localization studies. When designing vectors, inclusion of H. influenzae-specific uptake sequences may improve natural transformation efficiency for those strains that are transformable. For genetic complementation studies, integration of the crcB gene into the chromosome using techniques similar to those described for phage integration sites might provide more physiologically relevant expression levels .

What bioinformatic approaches help in analyzing the evolutionary conservation of CrcB homologs?

For analyzing evolutionary conservation of CrcB homologs, researchers should implement a comprehensive bioinformatic pipeline:

• Sequence retrieval: Extract CrcB sequences from diverse bacterial species using databases like UniProt, RefSeq, and specialized resources for H. influenzae genomics

• Multiple sequence alignment (MSA): Align sequences using algorithms optimized for transmembrane proteins (e.g., MAFFT with parameters adjusted for membrane proteins)

• Phylogenetic analysis:

  • Construct maximum likelihood or Bayesian trees

  • Implement models accounting for transmembrane protein evolution

  • Calculate bootstrap values or posterior probabilities to assess confidence

• Conservation analysis:

  • Calculate per-residue conservation scores

  • Map conservation onto predicted structural models

  • Identify functional motifs shared across homologs

• Comparative genomics:

  • Analyze genomic context of crcB in different species

  • Identify co-evolved genes that might functionally interact with CrcB

This approach would enable researchers to place H. influenzae CrcB within its evolutionary context, similar to analyses performed for other H. influenzae proteins like AcrB . The analysis should specifically examine whether CrcB in H. influenzae represents an ancestral or derived form, providing insights into the adaptation of this pathogen to its human host niche. Dating analyses using relaxed molecular clock methods could correlate CrcB evolution with key events in bacterial adaptation.

How should researchers interpret functional differences between recombinant and native CrcB homolog?

When interpreting functional differences between recombinant and native CrcB homolog, researchers should systematically consider several factors that might contribute to observed variations:

• Expression system effects:

  • Post-translational modifications may differ between expression systems and native H. influenzae

  • Membrane composition affects protein folding and function, particularly for channel proteins

  • Expression levels in recombinant systems often exceed physiological concentrations

• Purification artifacts:

  • Detergent effects on protein conformation and activity

  • Presence/absence of stabilizing lipids or small molecules

  • Tag interference with function or interactions

• Experimental context differences:

  • Buffer conditions (pH, ionic strength) between in vitro and cellular environments

  • Absence of native interaction partners in reconstituted systems

  • Differences in membrane potential or electrochemical gradients

To minimize misinterpretation, researchers should validate findings through multiple approaches, including complementation studies in crcB knockout strains of H. influenzae and careful controls for expression system effects. When comparing functional data between recombinant and native contexts, normalizing to protein abundance and accounting for membrane environment differences is essential. The conjugal expression system described for H. influenzae might provide advantages for studying the protein in a near-native context .

What statistical approaches are most appropriate for analyzing CrcB homolog structure-function relationship data?

For analyzing structure-function relationship data for CrcB homolog, researchers should apply statistical methods tailored to the specific experimental approaches:

• For mutagenesis studies:

  • Multiple linear regression to correlate amino acid properties with functional outcomes

  • Principal component analysis to identify patterns in multidimensional functional data

  • Hierarchical clustering to group mutations with similar functional impacts

• For electrophysiological data:

  • Non-linear regression for fitting channel kinetic models

  • Markov state modeling for complex gating behaviors

  • Bootstrap resampling to establish confidence intervals for kinetic parameters

• For evolutionary analyses:

  • Phylogenetic comparative methods to correlate sequence features with functional traits

  • Tests for selective pressure (dN/dS ratios) on specific residues or domains

  • Bayesian approaches for inferring ancestral states and functional shifts

• For structural studies:

  • Statistical validation of structural models (Ramachandran plots, RMSD analyses)

  • Ensemble approaches when analyzing flexibility from molecular dynamics simulations

  • Careful outlier analysis when integrating data from multiple biophysical techniques

In all cases, researchers should report effect sizes alongside p-values, implement appropriate multiple testing corrections, and validate findings across independent experimental replicates. For complex datasets, consulting with statistical specialists is recommended to ensure appropriate model selection and implementation.

How can researchers systematically compare CrcB homolog function across different H. influenzae strains?

Systematic comparison of CrcB homolog function across H. influenzae strains requires a structured experimental framework:

• Strain selection strategy:

  • Include representatives from encapsulated and nonencapsulated (nontypeable) lineages

  • Sample from diverse clinical and commensal isolates

  • Include strains with sequenced genomes for correlation with genetic background

• Standardized functional assays:

  • Fluoride sensitivity testing under controlled conditions

  • Gene expression analysis of crcB under varying fluoride concentrations

  • Membrane potential measurements to assess channel activity

  • If possible, electrophysiological characterization in consistent membrane environments

• Genetic manipulation across strains:

  • Implement consistent knockout and complementation strategies

  • Use the conjugal transfer system to introduce identical expression constructs

  • Control for expression levels through qRT-PCR or western blotting

• Data integration framework:

  • Correlate functional parameters with:

    • crcB sequence variations

    • Genomic context and strain phylogeny

    • Clinical or environmental source

This approach would allow researchers to distinguish strain-specific adaptations from core conserved functions, similar to approaches used for studying AcrB across H. influenzae strains . Special attention should be paid to potential interactions with strain-specific factors like the outer membrane composition, which has been shown to affect antibiotic susceptibility in H. influenzae through porins like OmpP2 .

What controls are essential when measuring ion transport activity of the CrcB homolog?

When measuring ion transport activity of the CrcB homolog, implementing rigorous controls is essential for reliable data interpretation:

• System-specific controls:

  • For liposome-reconstituted systems:

    • Protein-free liposomes to establish baseline leakage

    • Heat-denatured protein controls to confirm specific activity

    • Liposomes with known transporters as positive controls

  • For cellular systems:

    • crcB knockout strains as negative controls

    • Complemented strains expressing wild-type CrcB

    • Strains expressing known fluoride transporters as positive controls

• Specificity controls:

  • Test multiple ions to confirm fluoride selectivity

  • Implement known channel blockers

  • Use point mutations in predicted pore-lining residues

• Technical controls:

  • Standardize membrane potential or ion gradients across experiments

  • Include calibration standards for fluorescent or electrode-based measurements

  • Account for temperature effects on transport kinetics

• Expression controls:

  • Verify protein expression levels through western blotting

  • Confirm proper membrane localization via fractionation or microscopy

  • Ensure comparable protein:lipid ratios in reconstituted systems

By implementing these controls, researchers can distinguish genuine CrcB-mediated fluoride transport from artifacts and establish rigorous structure-function relationships. Particularly important is accounting for the effect of membrane composition, which may differ significantly between H. influenzae and model systems, potentially affecting channel properties.