Haemophilus influenzae is a gram-negative bacterium that can cause serious infections, particularly in children, including meningitis, pneumonia, and bacteremia. Like all bacteria, H. influenzae requires sophisticated systems to transport proteins across its cell membrane. The Sec (secretion) pathway represents one of the major protein export systems in this organism, responsible for the translocation of proteins across the cytoplasmic membrane into the periplasmic space or for insertion into the membrane itself .
SecG is an integral membrane component of the Sec translocase complex in H. influenzae. While not absolutely essential for viability in all conditions, SecG significantly enhances the efficiency of protein export, particularly under stress conditions. The protein is encoded by the secG gene, also designated as HI_0445 in the H. influenzae genome . This gene is positioned between the tRNA4Leu gene and fruA (HI0446) in the genomic context .
The recombinant form of H. influenzae SecG represents a purified version of this protein produced through genetic engineering techniques, allowing for detailed structural and functional studies outside the native bacterial environment. Understanding this protein is crucial for comprehending bacterial protein secretion mechanisms and potentially developing new antimicrobial strategies.
The SecG protein from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) consists of 112 amino acids. Its complete amino acid sequence is:
MYQVLLFIYVVVAIALIGFILVQQGKGANAGASFGGGASGTMFGSAGAGNFLTRTSAILATAFFVIALVLGNMNSHKGNVQKGTFDDLSQAAEQVQQQAAPAKDNKNSDIPQ
The protein has a distinct hydrophobic profile consistent with its role as a membrane protein, featuring transmembrane segments that anchor it within the cytoplasmic membrane. This hydrophobicity is particularly evident in the N-terminal region as indicated by the prevalence of hydrophobic residues like leucine (L), isoleucine (I), valine (V), and phenylalanine (F).
Table 1: Key Properties of H. influenzae SecG Protein
| Property | Characteristic |
|---|---|
| UniProt Accession | P44713 |
| Gene Name | secG |
| Locus Name | HI_0445 |
| Length | 112 amino acids |
| Expression Region | 1-112 |
| Protein Family | SecG family |
| Primary Function | Protein export membrane protein |
| Cellular Location | Cytoplasmic membrane |
| Role | Component of Sec translocation machinery |
The genomic location of secG provides insights into the evolutionary history of H. influenzae. The insertion of the HiGI1 genetic island between secG and fruA in type b strains suggests that this region may be a hotspot for genomic rearrangements or horizontal gene transfer events. The HiGI1 island is inserted at the 3′ end of the tRNA4Leu gene and is flanked by 23-bp direct repeats (DR1), indicating possible integration through a bacteriophage-like mechanism .
The Sec pathway is a central protein export system in bacteria, responsible for translocating proteins across the cytoplasmic membrane. This system consists of several key components that work together to facilitate the movement of proteins:
SecA: An ATPase that acts as the molecular motor driving protein translocation by coupling ATP hydrolysis to protein movement .
SecYEG: A heterotrimeric membrane channel complex through which proteins are transported .
SecB: A cytoplasmic chaperone that maintains preproteins in a translocation-competent state .
SecD/F: Accessory membrane proteins that enhance translocation efficiency .
The Sec system primarily handles the export of unfolded proteins, which is distinct from certain specialized export systems that can transport folded proteins with cofactors, such as the twin-arginine translocation (Tat) pathway mentioned in the search results .
SecG functions as an integral component of the SecYEG channel complex, which forms the protein-conducting channel through the cytoplasmic membrane. While not absolutely essential for viability in laboratory conditions, SecG enhances the efficiency of protein translocation, particularly under stressful conditions such as low temperature or when dealing with certain challenging substrate proteins.
According to the search results, SecG is "involved in protein export" and "participates in an early event of protein translocation" . This suggests that SecG plays a role in the initial stages of the translocation process, possibly in the recognition or initial threading of substrate proteins into the translocation channel.
The functional significance of SecG is highlighted by its conservation across bacterial species and its strong interaction network with other components of the Sec system. The integration of SecG into the SecYEG complex likely provides structural stability and optimizes the channel configuration for efficient protein transport.
SecG functions as part of an intricate network of protein interactions within the Sec translocation machinery. Based on the STRING database information provided in the search results, SecG demonstrates significant interactions with multiple components of the Sec system .
Table 2: SecG Interactions with Other Sec Components
| Interaction Partner | Function | Interaction Score |
|---|---|---|
| SecY | Central subunit of protein translocation channel | 0.999 |
| SecB | Molecular chaperone for preproteins | 0.998 |
| SecE | Essential subunit clamping SecY halves together | 0.962 |
| SecA | ATP-driven motor driving translocation | 0.957 |
| SecD | Accessory membrane protein enhancing translocation | Not specified |
These high interaction scores (on a scale from 0 to 1) indicate that SecG is tightly integrated into the Sec machinery. The strongest interactions are with SecY and SecB, suggesting that SecG works closely with these components during the translocation process.
The SecYEG complex (composed of SecY, SecE, and SecG) forms the core protein-conducting channel through which substrate proteins are transported. SecY constitutes the central pore-forming subunit, consisting of two halves that can open laterally to allow transmembrane segments to exit into the lipid bilayer. SecE stabilizes this arrangement by clamping the two halves of SecY together. SecG enhances the efficiency of this complex, particularly under challenging conditions .
The interaction with SecA is especially significant, as SecA couples ATP hydrolysis to the physical movement of proteins through the SecYEG channel. SecG may facilitate the insertion and cycling of SecA during the translocation process, enhancing the energy coupling between ATP hydrolysis and protein movement.
The search results include information about commercially available recombinant H. influenzae SecG protein for research applications . This recombinant protein is likely produced through expression in heterologous systems such as Escherichia coli, purified using affinity chromatography, and formulated for research applications.
Table 3: Specifications for Recombinant H. influenzae SecG
| Specification | Details |
|---|---|
| Quantity | 50 μg (other quantities available upon inquiry) |
| Product Type | Recombinant Protein |
| Species | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
| Tag Information | Determined during production process |
| Storage Buffer | Tris-based buffer, 50% glycerol, optimized for the protein |
| Storage Conditions | -20°C; for extended storage, -20°C or -80°C |
| Working Storage | 4°C for up to one week |
| Price | $1,453.00 / €1,453.00 |
| Notes | Repeated freezing and thawing not recommended |
Applications for recombinant H. influenzae SecG include:
Structural studies to determine the three-dimensional conformation of the protein
Functional assays to investigate its role in protein translocation
Development of antibodies for detection and localization studies
In vitro reconstitution of the Sec translocation system
Drug development research targeting bacterial protein secretion
The availability of purified recombinant SecG enables researchers to study this protein outside its native membrane environment, facilitating experiments that would be challenging or impossible with the native protein in its cellular context.
Research on H. influenzae SecG and the broader Sec translocation system continues to evolve, with several promising directions for future investigation:
Structural studies: Determining the high-resolution three-dimensional structure of H. influenzae SecG, particularly in the context of the complete SecYEG complex, would provide valuable insights into its mechanism of action.
Dynamics of SecG function: Investigating how SecG facilitates protein translocation at the molecular level, potentially involving conformational changes during the translocation cycle.
Species-specific features: Comparative analyses of SecG proteins from different bacterial species could reveal adaptations specific to H. influenzae and its pathogenic lifestyle.
Antimicrobial targeting: Exploring the potential of SecG or the SecYEG complex as targets for novel antimicrobial compounds, given their essential role in bacterial protein secretion.
Interaction with non-Sec components: Investigating whether SecG interacts with components of other cellular systems beyond the core Sec machinery, potentially revealing unexpected roles.
These research directions could advance our understanding of bacterial protein secretion mechanisms and potentially lead to new therapeutic approaches for H. influenzae infections.
KEGG: hin:HI0445
STRING: 71421.HI0445
The secG gene itself appears to be conserved across different H. influenzae strains regardless of their serotype. In contrast to the variability of genetic elements like the HiGI1 island (which exists in all 22 type b strains tested but only in 2 of 21 nontypeable H. influenzae strains), secG represents part of the core genome necessary for protein translocation . The genomic mapping data shows that secG serves as a consistent landmark for identifying strain-specific genetic variations, indicating its conservation across the species .
SecG functions as a protein translocation protein in H. influenzae . As part of the bacterial Sec translocon machinery, it facilitates the translocation of proteins across the cytoplasmic membrane. While the provided research doesn't detail SecG's specific mechanism in H. influenzae, its annotation as HI0445 in the Rd genome and its conservation across strains indicate its essential role in protein secretion. The protein export function is critical for bacterial viability and pathogenicity, as many virulence factors require proper translocation to the cell surface or extracellular environment.
Based on established protocols for other H. influenzae proteins, a recommended approach would include:
Cloning strategy: Design primers that amplify the full secG gene with appropriate restriction sites. For mammalian expression, consider codon optimization and adding a signal sequence if necessary.
Expression system selection: For structural and functional studies, consider using a mammalian cell line expression system similar to that described for influenza proteins . This approach can preserve proper folding and post-translational modifications.
Vector selection: Choose a vector with a strong promoter and appropriate tags for purification. Consider adding oligomerization domains if SecG functions as part of a complex .
Purification approach: Immobilized Metal Affinity Chromatography (IMAC) is effective for purifying recombinant proteins with histidine tags . For membrane proteins like SecG, addition of detergents or amphipols during purification will help maintain protein stability.
When transforming H. influenzae with secG constructs:
Ensure competent cell preparation: Use cells in exponential growth when filtered for MIV competence development. Do not let the culture sit before filtering; keep the optical density below OD600=0.3 .
Consider DNA structure: For plasmids containing secG, linearize them if integration into the chromosome is desired. For autonomous replication, use glycerol shock to promote passage of intact plasmid into the cytoplasm .
Uptake signal sequences: While H. influenzae preferentially takes up DNA containing the uptake signal sequence (USS) AAGTGCGGT, the absence of USS from particular genes doesn't typically limit transformation. Most genomic fragments are large enough to carry multiple USS elements .
Transformation conditions: Incubate DNA with competent cells in MIV medium at 37°C for 30 minutes to achieve optimal transformation .
Assess transformation frequency: Calculate by dividing the number of transformants per ml by the total number of cells per ml when using excess chromosomal DNA .
For membrane proteins like SecG:
Extraction protocol: Use gentle detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin to solubilize SecG from membranes while maintaining its native conformation.
Affinity purification: IMAC with nickel or cobalt resins works effectively for His-tagged constructs . For optimal purity, consider a two-step approach combining IMAC with size exclusion chromatography.
Optimization considerations:
Buffer composition: Include stabilizing agents such as glycerol (10-15%)
pH range: Test between 7.0-8.0 for optimal stability
Salt concentration: 150-300 mM NaCl typically provides stability
Quality control: Assess purity through SDS-PAGE and Western blotting. For membrane proteins like SecG, functional integrity can be evaluated through reconstitution assays or proteoliposome-based functional tests.
Multiple approaches can be employed to assess SecG function:
In vitro translocation assays:
Reconstitute purified SecG with other Sec translocon components in proteoliposomes
Use radiolabeled or fluorescently tagged substrate proteins
Measure translocation efficiency by protease protection assays
Genetic complementation approaches:
Generate secG deletion strains in H. influenzae
Complement with wild-type or mutant secG variants
Assess growth phenotypes under different conditions
Interactome analysis:
Perform crosslinking studies to identify proteins interacting with SecG
Use pull-down assays with tagged SecG to isolate protein complexes
Analyze by mass spectrometry to identify interaction partners
Site-directed mutagenesis:
Target conserved residues in SecG
Assess effects on protein translocation and cell viability
Compare results with known Sec pathway mechanisms
While secG itself is conserved across pathogenic and non-pathogenic H. influenzae strains, its genomic context differs significantly. In pathogenic type b strains, the HiGI1 island is inserted between secG and fruA . This genomic organization could potentially affect secG regulation or function.
Experimental approaches to investigate this relationship include:
Comparative expression analysis: Measure secG expression levels in different strains (pathogenic vs. non-pathogenic) using qRT-PCR or RNA-seq.
Regulatory element identification: Analyze promoter regions and potential regulatory elements affecting secG expression.
Protein localization studies: Use immunofluorescence or GFP-fusions to determine if SecG localization differs between pathogenic and non-pathogenic strains.
Secretome analysis: Compare the profiles of secreted proteins in wild-type and secG-modified strains to identify SecG-dependent virulence factors.
CRISPR-Cas9 technology offers powerful tools for studying secG:
Gene knockout strategies:
Design guide RNAs targeting secG
Use CRISPR-Cas9 system adapted for H. influenzae
Generate clean deletions or insertions at the secG locus
CRISPRi for controlled expression:
Use catalytically inactive Cas9 (dCas9) fused to repressors
Target secG promoter for transcriptional repression
Create conditional knockdowns to study essential functions
Precise genetic modifications:
Introduce point mutations to study specific residues
Create domain swaps between secG from different species
Generate reporter fusions for localization studies
Multiplexed gene editing:
Simultaneously target secG and other Sec pathway components
Create double/triple mutants to study genetic interactions
Assess synthetic lethality or enhancement phenotypes
The HiGI1 locus represents a significant genomic island specifically found in pathogenic H. influenzae type b strains . Its insertion between secG and fruA may have important implications:
Evolutionary significance: The HiGI1 locus appears to have been acquired by an ancestral type b strain, as it exists in all 22 type b strains tested but only in 2 of 21 nontypeable H. influenzae strains examined . This suggests a possible role in the evolution of type b strain pathogenicity.
Potential regulatory effects: The insertion may affect local chromosomal architecture and potentially influence the regulation of neighboring genes, including secG.
Insertion mechanism: The HiGI1 locus is inserted at the 3′ end of tRNA 4 Leu and contains an integrase gene encoding a CP4-57 like integrase, suggesting acquisition through phage-mediated horizontal gene transfer .
G+C content variation: The HiGI1 locus contains regions with G+C content that differs from the average genomic G+C content of H. influenzae, further supporting its foreign origin .
Several mapping techniques can be employed to characterize the secG locus:
Pulsed-field gel electrophoresis (PFGE): This method has been successfully used to map genetic islands in H. influenzae, including the HiGI1 locus near secG . PFGE allows the separation of large DNA fragments and can identify strain-specific variations.
Southern hybridization: Probes based on sequences within or flanking secG can be used to screen different H. influenzae strains to determine the presence and context of secG and associated genetic elements .
Long PCR approaches: Using primers designed from known sequences (e.g., secG and fruA), long PCR can amplify intervening regions, allowing identification of insertions or deletions .
Whole genome sequencing: Modern sequencing technologies provide comprehensive mapping of secG and surrounding regions across multiple strains. Long-read sequencing is particularly valuable for resolving complex genomic arrangements.
Comparative genomics: Bioinformatic analysis of multiple sequenced genomes can identify conserved and variable regions surrounding secG, providing insights into evolutionary patterns.
Based on general bacterial secretion systems knowledge:
Sec translocon components: SecG likely functions as part of the core Sec translocon, interacting with:
SecY and SecE to form the channel complex
SecA, the ATPase that drives translocation
SecD, SecF, and YajC, which enhance translocation efficiency
Experimental approaches to confirm interactions:
Co-immunoprecipitation with tagged SecG
Bacterial two-hybrid assays to detect specific interactions
Blue native PAGE to isolate intact complexes
Crosslinking followed by mass spectrometry to identify interaction partners
To investigate the effects of SecG mutations:
Targeted mutagenesis approaches:
Site-directed mutagenesis of conserved residues
Domain deletion/swapping experiments
Introduction of temperature-sensitive mutations
Phenotypic analyses:
Growth curve analysis under various stress conditions
Membrane integrity assays
Protein secretion profiling
Animal infection models to assess virulence
Secretion efficiency measurements:
Reporter protein assays using SecG-dependent secreted proteins
Pulse-chase experiments to track protein translocation kinetics
Accumulation of precursor proteins in the cytoplasm
While specific structural data for H. influenzae SecG is not provided in the search results, general approaches to determine critical structural features include:
Comparative structural analysis:
Homology modeling based on known bacterial SecG structures
Identification of conserved domains and residues across species
Prediction of transmembrane topology
Functional validation of structural predictions:
Alanine scanning mutagenesis of predicted functional regions
Cysteine accessibility studies to map membrane topology
Chimeric protein construction to identify domain-specific functions
Advanced structural studies:
Cryo-electron microscopy of SecG alone or in complex
X-ray crystallography of purified protein
NMR studies of specific domains