Recombinant Haemophilus influenzae Protein-export membrane protein SecG (secG)

Shipped with Ice Packs
In Stock

Description

Introduction to SecG in Haemophilus influenzae

Haemophilus influenzae is a gram-negative bacterium that can cause serious infections, particularly in children, including meningitis, pneumonia, and bacteremia. Like all bacteria, H. influenzae requires sophisticated systems to transport proteins across its cell membrane. The Sec (secretion) pathway represents one of the major protein export systems in this organism, responsible for the translocation of proteins across the cytoplasmic membrane into the periplasmic space or for insertion into the membrane itself .

SecG is an integral membrane component of the Sec translocase complex in H. influenzae. While not absolutely essential for viability in all conditions, SecG significantly enhances the efficiency of protein export, particularly under stress conditions. The protein is encoded by the secG gene, also designated as HI_0445 in the H. influenzae genome . This gene is positioned between the tRNA4Leu gene and fruA (HI0446) in the genomic context .

The recombinant form of H. influenzae SecG represents a purified version of this protein produced through genetic engineering techniques, allowing for detailed structural and functional studies outside the native bacterial environment. Understanding this protein is crucial for comprehending bacterial protein secretion mechanisms and potentially developing new antimicrobial strategies.

Amino Acid Sequence and Properties

The SecG protein from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) consists of 112 amino acids. Its complete amino acid sequence is:

MYQVLLFIYVVVAIALIGFILVQQGKGANAGASFGGGASGTMFGSAGAGNFLTRTSAILATAFFVIALVLGNMNSHKGNVQKGTFDDLSQAAEQVQQQAAPAKDNKNSDIPQ

The protein has a distinct hydrophobic profile consistent with its role as a membrane protein, featuring transmembrane segments that anchor it within the cytoplasmic membrane. This hydrophobicity is particularly evident in the N-terminal region as indicated by the prevalence of hydrophobic residues like leucine (L), isoleucine (I), valine (V), and phenylalanine (F).

Table 1: Key Properties of H. influenzae SecG Protein

PropertyCharacteristic
UniProt AccessionP44713
Gene NamesecG
Locus NameHI_0445
Length112 amino acids
Expression Region1-112
Protein FamilySecG family
Primary FunctionProtein export membrane protein
Cellular LocationCytoplasmic membrane
RoleComponent of Sec translocation machinery

Genetic Context of secG in H. influenzae

The genomic location of secG provides insights into the evolutionary history of H. influenzae. The insertion of the HiGI1 genetic island between secG and fruA in type b strains suggests that this region may be a hotspot for genomic rearrangements or horizontal gene transfer events. The HiGI1 island is inserted at the 3′ end of the tRNA4Leu gene and is flanked by 23-bp direct repeats (DR1), indicating possible integration through a bacteriophage-like mechanism .

The Sec Protein Transport System

The Sec pathway is a central protein export system in bacteria, responsible for translocating proteins across the cytoplasmic membrane. This system consists of several key components that work together to facilitate the movement of proteins:

  1. SecA: An ATPase that acts as the molecular motor driving protein translocation by coupling ATP hydrolysis to protein movement .

  2. SecYEG: A heterotrimeric membrane channel complex through which proteins are transported .

  3. SecB: A cytoplasmic chaperone that maintains preproteins in a translocation-competent state .

  4. SecD/F: Accessory membrane proteins that enhance translocation efficiency .

The Sec system primarily handles the export of unfolded proteins, which is distinct from certain specialized export systems that can transport folded proteins with cofactors, such as the twin-arginine translocation (Tat) pathway mentioned in the search results .

SecG's Specific Function

SecG functions as an integral component of the SecYEG channel complex, which forms the protein-conducting channel through the cytoplasmic membrane. While not absolutely essential for viability in laboratory conditions, SecG enhances the efficiency of protein translocation, particularly under stressful conditions such as low temperature or when dealing with certain challenging substrate proteins.

According to the search results, SecG is "involved in protein export" and "participates in an early event of protein translocation" . This suggests that SecG plays a role in the initial stages of the translocation process, possibly in the recognition or initial threading of substrate proteins into the translocation channel.

The functional significance of SecG is highlighted by its conservation across bacterial species and its strong interaction network with other components of the Sec system. The integration of SecG into the SecYEG complex likely provides structural stability and optimizes the channel configuration for efficient protein transport.

Interactions with Other Sec Components

SecG functions as part of an intricate network of protein interactions within the Sec translocation machinery. Based on the STRING database information provided in the search results, SecG demonstrates significant interactions with multiple components of the Sec system .

Table 2: SecG Interactions with Other Sec Components

Interaction PartnerFunctionInteraction Score
SecYCentral subunit of protein translocation channel0.999
SecBMolecular chaperone for preproteins0.998
SecEEssential subunit clamping SecY halves together0.962
SecAATP-driven motor driving translocation0.957
SecDAccessory membrane protein enhancing translocationNot specified

These high interaction scores (on a scale from 0 to 1) indicate that SecG is tightly integrated into the Sec machinery. The strongest interactions are with SecY and SecB, suggesting that SecG works closely with these components during the translocation process.

The SecYEG complex (composed of SecY, SecE, and SecG) forms the core protein-conducting channel through which substrate proteins are transported. SecY constitutes the central pore-forming subunit, consisting of two halves that can open laterally to allow transmembrane segments to exit into the lipid bilayer. SecE stabilizes this arrangement by clamping the two halves of SecY together. SecG enhances the efficiency of this complex, particularly under challenging conditions .

The interaction with SecA is especially significant, as SecA couples ATP hydrolysis to the physical movement of proteins through the SecYEG channel. SecG may facilitate the insertion and cycling of SecA during the translocation process, enhancing the energy coupling between ATP hydrolysis and protein movement.

Recombinant Production and Applications

The search results include information about commercially available recombinant H. influenzae SecG protein for research applications . This recombinant protein is likely produced through expression in heterologous systems such as Escherichia coli, purified using affinity chromatography, and formulated for research applications.

Table 3: Specifications for Recombinant H. influenzae SecG

SpecificationDetails
Quantity50 μg (other quantities available upon inquiry)
Product TypeRecombinant Protein
SpeciesHaemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Tag InformationDetermined during production process
Storage BufferTris-based buffer, 50% glycerol, optimized for the protein
Storage Conditions-20°C; for extended storage, -20°C or -80°C
Working Storage4°C for up to one week
Price$1,453.00 / €1,453.00
NotesRepeated freezing and thawing not recommended

Applications for recombinant H. influenzae SecG include:

  1. Structural studies to determine the three-dimensional conformation of the protein

  2. Functional assays to investigate its role in protein translocation

  3. Development of antibodies for detection and localization studies

  4. In vitro reconstitution of the Sec translocation system

  5. Drug development research targeting bacterial protein secretion

The availability of purified recombinant SecG enables researchers to study this protein outside its native membrane environment, facilitating experiments that would be challenging or impossible with the native protein in its cellular context.

Future Research Directions

Research on H. influenzae SecG and the broader Sec translocation system continues to evolve, with several promising directions for future investigation:

  1. Structural studies: Determining the high-resolution three-dimensional structure of H. influenzae SecG, particularly in the context of the complete SecYEG complex, would provide valuable insights into its mechanism of action.

  2. Dynamics of SecG function: Investigating how SecG facilitates protein translocation at the molecular level, potentially involving conformational changes during the translocation cycle.

  3. Species-specific features: Comparative analyses of SecG proteins from different bacterial species could reveal adaptations specific to H. influenzae and its pathogenic lifestyle.

  4. Antimicrobial targeting: Exploring the potential of SecG or the SecYEG complex as targets for novel antimicrobial compounds, given their essential role in bacterial protein secretion.

  5. Interaction with non-Sec components: Investigating whether SecG interacts with components of other cellular systems beyond the core Sec machinery, potentially revealing unexpected roles.

These research directions could advance our understanding of bacterial protein secretion mechanisms and potentially lead to new therapeutic approaches for H. influenzae infections.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please include your request in the order notes. We will fulfill your requirement whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors such as storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
secG; HI_0445; Protein-export membrane protein SecG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-112
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
secG
Target Protein Sequence
MYQVLLFIYVVVAIALIGFILVQQGKGANAGASFGGGASGTMFGSAGAGNFLTRTSAILA TAFFVIALVLGNMNSHKGNVQKGTFDDLSQAAEQVQQQAAPAKDNKNSDIPQ
Uniprot No.

Target Background

Function
SecG is involved in protein export and plays a role in the early stages of protein translocation.
Database Links

KEGG: hin:HI0445

STRING: 71421.HI0445

Protein Families
SecG family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How conserved is secG among different H. influenzae strains?

The secG gene itself appears to be conserved across different H. influenzae strains regardless of their serotype. In contrast to the variability of genetic elements like the HiGI1 island (which exists in all 22 type b strains tested but only in 2 of 21 nontypeable H. influenzae strains), secG represents part of the core genome necessary for protein translocation . The genomic mapping data shows that secG serves as a consistent landmark for identifying strain-specific genetic variations, indicating its conservation across the species .

What is the role of SecG in H. influenzae biology?

SecG functions as a protein translocation protein in H. influenzae . As part of the bacterial Sec translocon machinery, it facilitates the translocation of proteins across the cytoplasmic membrane. While the provided research doesn't detail SecG's specific mechanism in H. influenzae, its annotation as HI0445 in the Rd genome and its conservation across strains indicate its essential role in protein secretion. The protein export function is critical for bacterial viability and pathogenicity, as many virulence factors require proper translocation to the cell surface or extracellular environment.

What are the recommended protocols for recombinant expression of H. influenzae SecG?

Based on established protocols for other H. influenzae proteins, a recommended approach would include:

  • Cloning strategy: Design primers that amplify the full secG gene with appropriate restriction sites. For mammalian expression, consider codon optimization and adding a signal sequence if necessary.

  • Expression system selection: For structural and functional studies, consider using a mammalian cell line expression system similar to that described for influenza proteins . This approach can preserve proper folding and post-translational modifications.

  • Vector selection: Choose a vector with a strong promoter and appropriate tags for purification. Consider adding oligomerization domains if SecG functions as part of a complex .

  • Purification approach: Immobilized Metal Affinity Chromatography (IMAC) is effective for purifying recombinant proteins with histidine tags . For membrane proteins like SecG, addition of detergents or amphipols during purification will help maintain protein stability.

How can I optimize transformation efficiency when introducing recombinant secG constructs into H. influenzae?

When transforming H. influenzae with secG constructs:

  • Ensure competent cell preparation: Use cells in exponential growth when filtered for MIV competence development. Do not let the culture sit before filtering; keep the optical density below OD600=0.3 .

  • Consider DNA structure: For plasmids containing secG, linearize them if integration into the chromosome is desired. For autonomous replication, use glycerol shock to promote passage of intact plasmid into the cytoplasm .

  • Uptake signal sequences: While H. influenzae preferentially takes up DNA containing the uptake signal sequence (USS) AAGTGCGGT, the absence of USS from particular genes doesn't typically limit transformation. Most genomic fragments are large enough to carry multiple USS elements .

  • Transformation conditions: Incubate DNA with competent cells in MIV medium at 37°C for 30 minutes to achieve optimal transformation .

  • Assess transformation frequency: Calculate by dividing the number of transformants per ml by the total number of cells per ml when using excess chromosomal DNA .

What purification strategies are most effective for recombinant SecG protein?

For membrane proteins like SecG:

  • Extraction protocol: Use gentle detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin to solubilize SecG from membranes while maintaining its native conformation.

  • Affinity purification: IMAC with nickel or cobalt resins works effectively for His-tagged constructs . For optimal purity, consider a two-step approach combining IMAC with size exclusion chromatography.

  • Optimization considerations:

    • Buffer composition: Include stabilizing agents such as glycerol (10-15%)

    • pH range: Test between 7.0-8.0 for optimal stability

    • Salt concentration: 150-300 mM NaCl typically provides stability

  • Quality control: Assess purity through SDS-PAGE and Western blotting. For membrane proteins like SecG, functional integrity can be evaluated through reconstitution assays or proteoliposome-based functional tests.

How can I design functional assays to study SecG's role in protein translocation?

Multiple approaches can be employed to assess SecG function:

  • In vitro translocation assays:

    • Reconstitute purified SecG with other Sec translocon components in proteoliposomes

    • Use radiolabeled or fluorescently tagged substrate proteins

    • Measure translocation efficiency by protease protection assays

  • Genetic complementation approaches:

    • Generate secG deletion strains in H. influenzae

    • Complement with wild-type or mutant secG variants

    • Assess growth phenotypes under different conditions

  • Interactome analysis:

    • Perform crosslinking studies to identify proteins interacting with SecG

    • Use pull-down assays with tagged SecG to isolate protein complexes

    • Analyze by mass spectrometry to identify interaction partners

  • Site-directed mutagenesis:

    • Target conserved residues in SecG

    • Assess effects on protein translocation and cell viability

    • Compare results with known Sec pathway mechanisms

What is the relationship between secG and pathogenicity in H. influenzae?

While secG itself is conserved across pathogenic and non-pathogenic H. influenzae strains, its genomic context differs significantly. In pathogenic type b strains, the HiGI1 island is inserted between secG and fruA . This genomic organization could potentially affect secG regulation or function.

Experimental approaches to investigate this relationship include:

  • Comparative expression analysis: Measure secG expression levels in different strains (pathogenic vs. non-pathogenic) using qRT-PCR or RNA-seq.

  • Regulatory element identification: Analyze promoter regions and potential regulatory elements affecting secG expression.

  • Protein localization studies: Use immunofluorescence or GFP-fusions to determine if SecG localization differs between pathogenic and non-pathogenic strains.

  • Secretome analysis: Compare the profiles of secreted proteins in wild-type and secG-modified strains to identify SecG-dependent virulence factors.

How can CRISPR-Cas9-based approaches be used to study secG function in H. influenzae?

CRISPR-Cas9 technology offers powerful tools for studying secG:

  • Gene knockout strategies:

    • Design guide RNAs targeting secG

    • Use CRISPR-Cas9 system adapted for H. influenzae

    • Generate clean deletions or insertions at the secG locus

  • CRISPRi for controlled expression:

    • Use catalytically inactive Cas9 (dCas9) fused to repressors

    • Target secG promoter for transcriptional repression

    • Create conditional knockdowns to study essential functions

  • Precise genetic modifications:

    • Introduce point mutations to study specific residues

    • Create domain swaps between secG from different species

    • Generate reporter fusions for localization studies

  • Multiplexed gene editing:

    • Simultaneously target secG and other Sec pathway components

    • Create double/triple mutants to study genetic interactions

    • Assess synthetic lethality or enhancement phenotypes

What is the significance of the HiGI1 locus insertion near secG in type b strains?

The HiGI1 locus represents a significant genomic island specifically found in pathogenic H. influenzae type b strains . Its insertion between secG and fruA may have important implications:

  • Evolutionary significance: The HiGI1 locus appears to have been acquired by an ancestral type b strain, as it exists in all 22 type b strains tested but only in 2 of 21 nontypeable H. influenzae strains examined . This suggests a possible role in the evolution of type b strain pathogenicity.

  • Potential regulatory effects: The insertion may affect local chromosomal architecture and potentially influence the regulation of neighboring genes, including secG.

  • Insertion mechanism: The HiGI1 locus is inserted at the 3′ end of tRNA 4 Leu and contains an integrase gene encoding a CP4-57 like integrase, suggesting acquisition through phage-mediated horizontal gene transfer .

  • G+C content variation: The HiGI1 locus contains regions with G+C content that differs from the average genomic G+C content of H. influenzae, further supporting its foreign origin .

How can genomic mapping techniques be used to study the secG locus and associated genomic islands?

Several mapping techniques can be employed to characterize the secG locus:

  • Pulsed-field gel electrophoresis (PFGE): This method has been successfully used to map genetic islands in H. influenzae, including the HiGI1 locus near secG . PFGE allows the separation of large DNA fragments and can identify strain-specific variations.

  • Southern hybridization: Probes based on sequences within or flanking secG can be used to screen different H. influenzae strains to determine the presence and context of secG and associated genetic elements .

  • Long PCR approaches: Using primers designed from known sequences (e.g., secG and fruA), long PCR can amplify intervening regions, allowing identification of insertions or deletions .

  • Whole genome sequencing: Modern sequencing technologies provide comprehensive mapping of secG and surrounding regions across multiple strains. Long-read sequencing is particularly valuable for resolving complex genomic arrangements.

  • Comparative genomics: Bioinformatic analysis of multiple sequenced genomes can identify conserved and variable regions surrounding secG, providing insights into evolutionary patterns.

What protein complexes does SecG participate in within H. influenzae?

Based on general bacterial secretion systems knowledge:

  • Sec translocon components: SecG likely functions as part of the core Sec translocon, interacting with:

    • SecY and SecE to form the channel complex

    • SecA, the ATPase that drives translocation

    • SecD, SecF, and YajC, which enhance translocation efficiency

  • Experimental approaches to confirm interactions:

    • Co-immunoprecipitation with tagged SecG

    • Bacterial two-hybrid assays to detect specific interactions

    • Blue native PAGE to isolate intact complexes

    • Crosslinking followed by mass spectrometry to identify interaction partners

How do SecG mutations affect H. influenzae viability and pathogenicity?

To investigate the effects of SecG mutations:

  • Targeted mutagenesis approaches:

    • Site-directed mutagenesis of conserved residues

    • Domain deletion/swapping experiments

    • Introduction of temperature-sensitive mutations

  • Phenotypic analyses:

    • Growth curve analysis under various stress conditions

    • Membrane integrity assays

    • Protein secretion profiling

    • Animal infection models to assess virulence

  • Secretion efficiency measurements:

    • Reporter protein assays using SecG-dependent secreted proteins

    • Pulse-chase experiments to track protein translocation kinetics

    • Accumulation of precursor proteins in the cytoplasm

What structural features of SecG are critical for its function in H. influenzae?

While specific structural data for H. influenzae SecG is not provided in the search results, general approaches to determine critical structural features include:

  • Comparative structural analysis:

    • Homology modeling based on known bacterial SecG structures

    • Identification of conserved domains and residues across species

    • Prediction of transmembrane topology

  • Functional validation of structural predictions:

    • Alanine scanning mutagenesis of predicted functional regions

    • Cysteine accessibility studies to map membrane topology

    • Chimeric protein construction to identify domain-specific functions

  • Advanced structural studies:

    • Cryo-electron microscopy of SecG alone or in complex

    • X-ray crystallography of purified protein

    • NMR studies of specific domains

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.