Recombinant Haemophilus influenzae Protein hemY homolog (hemY)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipments.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference for your preparations.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
hemY; HI_0602; Protein HemY homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-428
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
hemY
Target Protein Sequence
MFRVLFLMLTLLVGLVAGPYISGQQGYVRIETANRIIEMSITTLVIFFIISLAIIYAFEW GVTRFFRLSRSSYQWFSNRKRVKAQKQTLEGLVKMDEGDYAKAEKLIGKNAKHSAEPVLN LIKAAEAAQQRGDEFSANRYLIEATELAGSDNLLVEIARTRILLQQNKLPAARSSVDSLL EMARRNKEVLKLAVEIYLRSKAYQALDKILDNVANSGLFNDEEFKDLRSKTENGLLDEKM NEEGIDGLLTWWNQQPRHRRNNIELKISLIQRLIDCNDHESATELTFEILKKLGDNTAIS LPLCTQITRLQPEDNSKLLKLIEKRAKRVDEKQKCCINRALGYLYVRNNEFIKAADVFKN VIACPEQLEQNDLMMASYVFEQAGDKALAEQVRQESLKSVMAIQDVIPESAEEKTEENST ALLESKSE
Uniprot No.

Target Background

Function
Involved in a late step of protoheme IX biosynthesis.
Database Links

KEGG: hin:HI0602

STRING: 71421.HI0602

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the hemY protein homolog in H. influenzae and what is its presumed function?

Based on research into H. influenzae protein systems, the hemY homolog likely functions within the heme acquisition and utilization pathway, similar to other heme-related proteins identified in H. influenzae. While not specifically detailed in the provided literature, hemY homologs in other bacteria are typically involved in heme biosynthesis or transport. In H. influenzae, proteins involved in heme utilization are critical virulence factors since the bacterium cannot synthesize heme endogenously and must acquire it from the host environment . This dependency makes proteins like hemY potential targets for antimicrobial development and vaccine research.

How does the heme acquisition system work in H. influenzae and where might hemY fit?

H. influenzae has developed sophisticated mechanisms for acquiring heme from various host sources. The bacterium can utilize heme from hemoglobin, hemoglobin-haptoglobin complexes, heme-hemopexin, and heme-albumin complexes . Several key proteins have been identified in this process, including the TonB protein, which is required for heme utilization and virulence , and HbpA (heme-binding protein A), which is important for utilizing heme complexed to hemopexin or albumin .

Research has also identified Protein E (PE), which can bind and store hemin at the bacterial surface. Importantly, PE-bound hemin can be donated to other H. influenzae bacteria that are starved of hemin, suggesting a role in hemin storage and distribution within bacterial communities . Given these systems, hemY may function as part of this complex heme acquisition pathway, potentially in heme processing, storage, or utilization.

What are effective strategies for cloning potentially unstable genes like hemY from H. influenzae?

Cloning genes from H. influenzae, particularly those that might be genetically unstable like hemY, requires specialized strategies. Based on approaches used for other challenging genes, two effective methods have been demonstrated:

  • Using RecA-deficient E. coli strains: Transformation of the target gene cloned into standard reverse genetics (RG) vectors (like pHW2000) into recA13 E. coli strains such as HB101 can stabilize otherwise unstable constructs .

  • Utilizing improved cloning vectors: Systems like the pMKP ccdB vector followed by transformation into commonly used E. coli strains (DH5α, XL1-blue) have been successful for unstable gene cloning .

For PCR amplification of H. influenzae genes, researchers have successfully used primers that introduce restriction sites, facilitating subsequent cloning steps. For example, the amplification of the H. influenzae enolase gene utilized XhoI and KpnI restriction sites incorporated into the primers .

What expression systems are most suitable for producing recombinant H. influenzae proteins?

For recombinant protein expression of H. influenzae proteins, E. coli-based systems have proven effective. A noteworthy approach involves using the T7-inducible promoter system, as demonstrated for the recombinant P4 protein of H. influenzae . This method involves:

  • Replacing the N-terminal lipid modification signal sequence with a protein secretion signal

  • Placing expression under control of the T7-inducible promoter

  • Inducing expression with IPTG

  • Purifying the recombinant protein through chromatography steps

This system achieved high levels of phosphomonoesterase activity while maintaining the functional properties of the wild-type protein, including substrate specificity, pH optimum, and response to various inhibitors . Similar strategies could be applied to hemY expression, with modifications based on its specific characteristics.

What purification techniques are most effective for recombinant H. influenzae proteins?

Purification of recombinant H. influenzae proteins typically involves multiple chromatography steps. For the recombinant P4 protein, apparent homogeneity was achieved after just two chromatography steps following IPTG induction . The specific purification strategy should be tailored to the properties of hemY, but generally includes:

  • Initial capture step: Often using affinity chromatography, such as His-tag-based purification

  • Polishing step: Using size exclusion chromatography or ion exchange chromatography

The success of this approach is evidenced by researchers being able to purify recombinant enzymes while maintaining their physicochemical properties similar to those of wild-type proteins, including molecular weight, primary structure, and functional characteristics .

For proteins with specific binding properties, specialized affinity purification methods may be employed. For instance, HbpA was purified using heme-agarose affinity purification , suggesting that if hemY has heme-binding properties, similar approaches might be effective.

What methodologies are most effective for determining the structure-function relationship of hemY?

Understanding the structure-function relationship of H. influenzae proteins involves multiple complementary approaches:

  • X-ray Crystallography: This has been successfully used to determine the structure of H. influenzae proteins, such as Protein E (PE). Structural analysis revealed that PE can simultaneously interact with host molecules like vitronectin, laminin, or plasminogen, promoting bacterial pathogenesis .

  • Peptide Mapping: This approach has been used to identify functional regions in PE, where the amino acid region 84-108 was found to be involved in binding to epithelial cells .

  • Site-Directed Mutagenesis: By systematically altering specific residues, researchers can identify critical amino acids for protein function.

  • Binding Assays: Surface plasmon resonance has been used to determine binding affinities of H. influenzae proteins for their ligands, such as the affinity (Kd) of 1.6 × 10⁻⁶ M for the hemin-PE interaction .

For hemY specifically, these methods could help identify binding pockets, active sites, and functional domains involved in its presumed role in heme metabolism or other functions.

How can transcriptomics and proteomics be integrated to understand hemY expression patterns?

Integrating transcriptomics and proteomics provides a comprehensive view of gene expression and protein levels. For H. influenzae, high-density microarrays containing oligonucleotides for approximately 1800 genes have been used to analyze transcriptional responses . This can be complemented with proteomic analyses using techniques such as 2D-gel electrophoresis.

Research on H. influenzae has shown that:

  • In response to stressors (like DNA gyrase inhibitors), about 55% of genes show concordant changes at both mRNA and protein levels .

  • Approximately 40% of changes are detected by only one technology, often due to threshold effects .

  • A small percentage (3.5%) show clear discrepancies between transcriptomics and proteomics data .

This integrated approach could reveal how hemY expression is regulated under different conditions, such as heme availability, oxidative stress, or host cell contact.

What is the role of conserved domains in hemY and how do they compare across species?

While specific information about hemY conserved domains is not provided in the search results, the approach used for other H. influenzae proteins is instructive. For example:

  • Sequence analysis has revealed that Protein E (PE) contains conserved domains, with the vitronectin-binding region (amino acids 84-106) being 100% conserved across H. influenzae strains .

  • Homologues of PE have been identified in other members of the Pasteurellaceae family, including Aggregatibacter spp., Actinobacillus spp., Mannheimia succiniciproducens, and Pasteurella multocida .

For hemY, similar analyses could identify:

  • Highly conserved domains that might be essential for function

  • Variations that might correlate with strain-specific differences in virulence or heme utilization

  • Homologs in related bacterial species that might provide insights into its evolutionary history and functional significance

How can mutant analysis be used to determine the function of hemY in H. influenzae?

Mutant analysis has been a powerful approach to determine protein function in H. influenzae. For example:

  • Insertional Mutagenesis: For the TonB protein, when the gene was inactivated by insertional mutagenesis in wild-type strains of H. influenzae type b, the resultant transformants lost their abilities to utilize heme and produce invasive disease in an animal model .

  • Chemical Mutagenesis: This approach was used to produce a mutant of a nontypeable H. influenzae strain unable to utilize either protein-bound forms of heme or low levels of free heme .

  • Complementation Studies: Genetic restoration of the ability to express TonB resulted in the simultaneous acquisition of both heme utilization ability and virulence .

For hemY, similar mutant analyses could determine:

  • Its role in heme acquisition or metabolism

  • Its importance for bacterial growth under various conditions

  • Its contribution to virulence in infection models

What animal models are appropriate for studying the role of hemY in H. influenzae virulence?

Several animal models have been used to study H. influenzae virulence factors:

  • Infant Rat Model: The 5-day-old and 30-day-old infant rat models have been used to study bacteremia caused by H. influenzae. For example, an hbpA mutant derivative of a type b strain caused bacteremia as well as the wild-type strain in 5-day-old infant rats but showed significantly lower rates of bacteremia than the wild-type strain in 30-day-old rats .

  • Chinchilla Model: This model has been used to study otitis media caused by nontypeable H. influenzae. For instance, an hbpA mutant of a nontypeable strain was indistinguishable from the wild-type strain in this model .

The choice of animal model depends on the specific aspect of hemY function being investigated:

  • For studying its role in invasive disease, the infant rat model would be appropriate

  • For respiratory infections, mouse pulmonary clearance models might be suitable

  • For otitis media, the chinchilla model would be relevant

What is the potential of hemY as a vaccine candidate against H. influenzae?

Evaluating hemY as a vaccine candidate would involve several considerations and approaches:

  • Conservation Analysis: A successful vaccine candidate should be highly conserved across strains. Similar to PE, which has been found to be ubiquitous in H. influenzae strains with 100% conservation of functional regions , hemY would need to be analyzed for conservation.

  • Immunogenicity Assessment: The ability to induce protective immune responses is critical. For example, peptides corresponding to surface-exposed regions of PE (PE 24-37, PE 74-89, and PE 134-156) were found to be immunogenic in mice, and antibodies against these peptides recognized PE at the bacterial surface .

  • Protection Studies: In vivo protection studies would be necessary. For example, immunization with the PE amino acid 84-108 peptide showed significantly better pulmonary clearance in a mouse model compared to an unrelated control peptide .

  • Epitope Mapping: Identifying B-cell and T-cell epitopes is important for vaccine development. As demonstrated for H. influenzae enolase, where 10 linear B-cell epitopes and 13 CTL epitopes were identified .

If hemY is surface-exposed and involved in critical functions like heme acquisition, it could be a promising vaccine candidate, especially if it shows high conservation across H. influenzae strains.

What are common challenges in expressing and purifying hemY, and how can they be addressed?

Based on experiences with other H. influenzae proteins, several challenges might arise when working with hemY:

  • Genetic Instability: H. influenzae genes can be unstable in standard cloning vectors. Solutions include:

    • Using RecA-deficient E. coli strains (like HB101)

    • Employing specialized vectors with additional genetic stability elements (like pMKP ccdB)

    • Optimizing growth conditions (temperature, antibiotic concentration)

  • Protein Solubility: If hemY forms inclusion bodies, strategies include:

    • Modifying growth conditions (lower temperature, reduced inducer concentration)

    • Using solubility-enhancing fusion tags

    • Refolding from inclusion bodies under optimized conditions

  • Purification Efficiency: For optimal purification:

    • Design a purification scheme based on hemY's predicted properties

    • Consider affinity tags that can be cleaved post-purification

    • Optimize buffer conditions to maintain protein stability

  • Lipid Modifications: If hemY is a lipoprotein (like many H. influenzae surface proteins), replacing N-terminal lipid modification signal sequences with protein secretion signals without such modification has proven effective .

How can researchers overcome the challenges of working with H. influenzae's natural competence in genetic studies of hemY?

H. influenzae's natural competence can be both an opportunity and a challenge. The transformed recombinant enrichment profiling (TREP) approach exemplifies how to leverage this characteristic:

  • TREP Methodology:

    • Natural transformation is used to generate complex pools of recombinants

    • Phenotypic selection enriches for specific recombinants

    • Deep sequencing surveys the genetic variation responsible for the phenotype

  • Challenges and Solutions:

    • DNA uptake specificity: Design transforming DNA with appropriate uptake signal sequences

    • Transformation efficiency: Optimize competence development conditions

    • Recombination specificity: Include sufficient homologous sequences flanking the target gene

  • Applications:

    • This approach can be used to investigate the genetic basis of phenotypic variation

    • It has successfully identified critical virulence factors like the HMW1 adhesin

For hemY studies, TREP could be used to investigate its role in various phenotypes, such as heme utilization or virulence, by generating and selecting for relevant recombinants.

What are the key considerations for designing immunological studies to evaluate hemY's potential as a vaccine candidate?

Designing immunological studies for hemY would require careful consideration of several factors:

  • Epitope Identification:

    ApproachApplication to hemYExpected Outcome
    In silico predictionSequence-based prediction of B and T cell epitopesCandidate epitope regions
    Peptide mappingSynthesis and testing of overlapping peptidesExperimentally validated epitopes
    Structural analysisIdentification of surface-exposed regionsAccessible epitopes for antibody binding
  • Antibody Generation and Characterization:

    • Recombinant protein or peptide immunization in animal models

    • Evaluation of antibody specificity using western blot analysis

    • Assessment of surface recognition using immunofluorescence

    • Functional assays to determine if antibodies interfere with hemY function

  • Protection Studies:

    • Animal models relevant to H. influenzae pathogenesis

    • Challenge studies with various H. influenzae strains

    • Evaluation of bacterial clearance, disease progression, and survival

  • Cross-Protection Analysis:

    • Testing antibodies against diverse H. influenzae isolates

    • Evaluating protection against heterologous challenge strains

    • Assessing conservation of protective epitopes across clinical isolates

This systematic approach would provide comprehensive data on hemY's immunological properties and vaccine potential.

How might high-throughput screening approaches be applied to identify inhibitors of hemY function?

High-throughput screening for hemY inhibitors could follow these methodological steps:

  • Assay Development:

    • Establish a functional assay based on hemY's presumed activity

    • Optimize for microplate format and automated readout

    • Validate with known activators/inhibitors if available

  • Screening Strategy:

    • Primary screen against diverse compound libraries

    • Counter-screening to eliminate false positives

    • Dose-response studies for promising hits

  • Hit Validation:

    • Orthogonal assays to confirm mechanism of action

    • Testing in bacterial growth/survival assays

    • Evaluation of specificity against other bacterial proteins

  • Lead Optimization:

    • Structure-activity relationship studies

    • Improvement of potency, selectivity, and pharmacological properties

    • Testing in relevant infection models

This approach could identify novel antimicrobial compounds targeting hemY, potentially addressing the growing problem of multidrug-resistant H. influenzae strains .

What is the potential role of hemY in H. influenzae's adaptation to different host environments?

Understanding hemY's role in adaptation requires investigating its expression and function under different host-relevant conditions:

  • Transcriptomic and Proteomic Analysis:

    • Compare hemY expression in different niches (nasopharynx vs. lung vs. bloodstream)

    • Analyze regulation in response to host factors (iron/heme availability, inflammatory mediators)

    • Examine expression in biofilms vs. planktonic growth

  • Host-Pathogen Interaction Studies:

    • Evaluate hemY's role in epithelial cell adhesion and invasion

    • Assess its contribution to survival within host cells

    • Investigate its importance for resistance to host defense mechanisms

  • Comparative Genomics Approach:

    • Analyze hemY sequence variation among strains with different host preferences

    • Correlate sequence polymorphisms with functional differences

    • Identify evidence of selective pressure from host environments

This research would contribute to understanding how H. influenzae adapts to diverse host environments and potentially identify new therapeutic targets.

How could systems biology approaches integrate hemY into the broader understanding of H. influenzae pathogenesis?

Systems biology approaches offer powerful tools to contextualize hemY within H. influenzae's pathogenesis mechanisms:

  • Network Analysis:

    • Construct protein-protein interaction networks including hemY

    • Identify pathways and processes connecting hemY to virulence mechanisms

    • Map relationships to other heme acquisition and utilization proteins

  • Multi-omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Develop predictive models of hemY's role in different infection scenarios

    • Identify emergent properties not apparent from single-omics approaches

  • Comparative Systems Analysis:

    • Contrast systems-level organization between typeable and non-typeable strains

    • Compare with other pathogens using similar virulence strategies

    • Identify conserved and divergent network modules

  • Host-Pathogen Systems Biology:

    • Model the interplay between bacterial and host networks

    • Predict effects of hemY manipulation on infection dynamics

    • Identify potential synergistic therapeutic targets

This systems-level understanding would place hemY within the broader context of H. influenzae pathogenesis and potentially reveal unexpected functional relationships and therapeutic opportunities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.