Haemophilus influenzae is a bacterium that can cause various infections, especially in children . Characterizing its proteins, like HflK, is crucial for understanding its pathogenicity and developing effective treatments . The protein HflK, also known as HI_0151, is a protein found in Haemophilus influenzae .
Recombinant HflK is produced in E. coli and fused with an N-terminal His tag . It is available as a lyophilized powder with greater than 90% purity, determined by SDS-PAGE . The molecular weight of the intact glycosylated lactoferrin from BHK cells was determined to be 79,338 Da, and glycosylated lactoferrin N-lobe was 36,890 Da .
| Feature | Description |
|---|---|
| Product Overview | Recombinant Full Length Haemophilus influenzae Protein HflK(hflK) Protein (P44546) (1-410aa), fused to N-terminal His tag, was expressed in E. coli. |
| Species | Haemophilus influenzae |
| Source | E. coli |
| Tag | His |
| Protein Length | Full Length (1-410) |
| Form | Lyophilized powder |
| AA Sequence | MENEMSQNGSDRDPWSKPGQSNDQQPGNSSNNNGWNNNQNRGNQEQSPPDIEEIFNNLLK KLGGGNKKSGQNNGSSQGNTPFHFGKVIPLAVAIGAIIWGVNGFYTIKEAERGVVLRFGE LHSIVQPGLNWKPTFVDKVLPVNVEQVKELRTQGAMLTQDENMVKVEMTVQYRVQDPAKY LFSVTNADDSLNQATDSALRYVIGHMSMNDILTTGRSVVRENTWKALNEIIKSYDMGLEV IDVNFQSARPPEEVKDAFDDAIKAQEDEQRFIREAEAYAREKEPIARGDAQRILEEATAY KDRIVLDAKGEVERLQRLLPEFKAAPDLLRERLYIQTMEKVMANTPKVMLDGNNGNNLTV LPLEQIMGKKSVTSAPSAVNSSPAFTAPERQNSYQPQPTTVAPIRQGRFN |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Applications | SDS-PAGE |
| Gene Name | hflK |
| Synonyms | hflK; HI_0151; Protein HflK |
| UniProt ID | P44546 |
| Storage | Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles. |
| Storage Buffer | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution | Briefly centrifuge prior to opening. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ is recommended. The default final concentration of glycerol is 50%. |
HflK is a full-length protein consisting of 410 amino acids . It is associated with the cell membrane. H. influenzae employs various autotransporters to adhere to epithelial cells, such as Hia and Hsf, which possess binding domains that facilitate this adhesion . Human milk lactoferrin can extract the IgA1 protease preprotein from the bacterial outer membrane and degrade the Hap adhesin, thus potentially interfering with colonization .
Haemophilus influenzae pathogenesis begins with the colonization of the upper respiratory mucosa, involving evasion of local immune mechanisms and adherence to epithelial cells . Proteins like HflK may play a role in these processes, though specific details require further investigation .
The hpd and fucK genes have shown high sensitivity and specificity in identifying Haemophilus influenzae and differentiating it from Haemophilus haemolyticus . PCR assays targeting these genes can aid in the confirmation of H. influenzae .
Human milk lactoferrin can inactivate IgA1 protease and Hap adhesin, suggesting a therapeutic potential in preventing H. influenzae colonization . Targeting surface structures like HMW1 could block the ability of H. influenzae to invade airway cells, making antibiotic therapy more effective .
Further research is needed to fully elucidate the function of HflK and its potential as a therapeutic target. Studies could focus on:
Detailed structural analysis to understand its interactions.
Investigating its role in biofilm formation.
Assessing its potential as a vaccine candidate.
KEGG: hin:HI0151
STRING: 71421.HI0151
Haemophilus influenzae Protein HflK is a membrane-associated protein encoded by the hflK gene (HI_0151) with UniProt ID P44546 . It functions as a regulatory subunit that associates with HflC to form the HflK/C complex, which in turn interacts with the AAA+ protease FtsH to form a megadalton-size complex spanning the inner membrane and extending into the periplasm . The full-length protein consists of 410 amino acids and contains distinctive structural domains including the SPFH (stomatin/prohibitin/flotillin/HflK/C) domain that plays a crucial role in its membrane association and function .
To study this protein experimentally, researchers should consider that HflK exists in a complex with HflC and interacts with FtsH hexamers through specific contacts, including those between Arg191 of HflK and residues 62-64 of the FtsH periplasmic domain . This interaction is critical for understanding the protein's functional role in bacterial physiology.
The HflK/C complex forms a remarkably asymmetric nautilus-like assembly surrounding FtsH hexamers, rather than a symmetric cage as previously thought . Recent cryo-EM studies at 4.4 Å resolution reveal that the periplasmic portion of the nautilus structure contains 24 alternating HflK and HflC subunits forming a hat-like region . SPFH domains, present in each HflK and HflC subunit, form the membrane-proximal sides of the nautilus chamber, with 21 of 24 domains being structurally resolved .
For structural characterization methodology, researchers should note that:
Signal subtraction and local refinement without symmetry can achieve higher resolution (3.5 Å) for specific regions
Side chain visualization requires resolution better than 3.7 Å
The nautilus-like structure appears independent of detergent choice (verified in both DDM and GDN)
3D-FSC measurements of sphericity (0.89) should be conducted to rule out orientation bias
The nautilus chamber has an entryway that allows membrane-embedded substrates to reach FtsH, which contradicts earlier models suggesting a completely enclosed structure .
The HflK/C complex plays a nuanced role in regulating FtsH protease activity, contrary to earlier models suggesting a purely inhibitory function. Mass spectrometry-based proteomic analysis of approximately 2,250 proteins revealed that in cells lacking HflK/C (ΔhflK/C), about 8% of proteins were more abundant and 4% were less abundant compared to wild-type cells . This indicates that HflK/C can both enhance and restrict FtsH-mediated degradation in a substrate-specific manner.
The enhanced degradation role is particularly evident for certain membrane proteins including DadA, PspC, SecY, and YlaC, which are known FtsH substrates and show increased abundance in ΔhflK/C cells . Experimental validation through affinity purification demonstrated that some differentially abundant proteins, including DadA and AstC, exhibit HflK/C-dependent association with FtsH .
For methodological approaches to study this regulation:
Compare steady-state protein levels between wild-type and ΔhflK/C strains using quantitative mass spectrometry
Perform affinity purification of FtsH from both strains to identify HflK/C-dependent interactions
Validate specific substrates through targeted degradation assays
Consider the structural features of the nautilus-like HflK/C complex, which provides an entryway for substrates unlike the closed cage model
These findings challenge previous interpretations that HflK/C primarily inhibits FtsH and suggest a more complex regulatory mechanism involving substrate recruitment and selectivity .
The asymmetric nautilus-like structure of HflK/C represents a paradigm shift in understanding FtsH- HflK/C complex organization and function. This structure, determined without imposed symmetry and from non-overexpressed proteins, reveals a HflK/C chamber with an opening that could allow membrane proteins to enter and be engaged by FtsH . This contrasts sharply with previously reported C4-symmetric structures showing HflK/C forming a tight cage around FtsH hexamers that would seemingly prevent access to membrane-embedded substrates .
The key methodological considerations for investigating this structure include:
Avoid protein overexpression artifacts that may favor symmetric assemblies
Conduct reconstructions without imposed symmetry
Use focused classification to identify structural heterogeneity
Compare structures obtained with different solubilization methods (DDM vs. GDN)
Validate through tomographic reconstructions to assess particle orientations
The functional significance is substantial: the nautilus structure provides a mechanistic explanation for how FtsH can access and degrade membrane proteins while associated with HflK/C . This supports proteomic data showing that HflK/C enhances rather than inhibits degradation of certain membrane substrates .
Researchers should consider that previous interpretations of nautilus-like structures as "ruptured states" or purification artifacts may need reevaluation in light of functional data showing HflK/C-dependent enhancement of membrane protein degradation .
Contrary to initial hypotheses, the curvature of the HflK/C nautilus chamber does not simply correlate with the number of enclosed FtsH hexamers. Focused classification and 3D refinement revealed assemblies containing either one or two FtsH hexamers, yet comparison of these maps showed no significant structural rearrangements in the nautilus shell . This indicates that chamber curvature is an intrinsic property of the HflK/C complex rather than a response to FtsH binding.
The methodological approach for investigating this relationship includes:
Perform focused classification using a mask encompassing specific FtsH hexamers
Compare structures with different FtsH occupancy
Analyze HflK/C-only structures obtained through overexpression
Use heterogeneity analysis tools such as cryoDRGN
The research revealed variability in the width of the entryway into the nautilus chamber, but closed HflK/C structures or complexes with four FtsH hexamers were not observed in datasets without imposed symmetry . This has important implications for understanding how the HflK/C complex functions in vivo and cautions against interpreting symmetric structures as the primary physiological state.
To investigate HflK/C's impact on intracellular protein levels, researchers successfully employed quantitative proteomics comparing wild-type E. coli and mutant cells lacking HflK/C (ΔhflK/C) . This approach identified approximately 2,250 proteins, of which 8% showed increased abundance and 4% showed decreased abundance in the mutant strain .
The most effective methodological workflow includes:
Generate appropriate genetic backgrounds (wild-type and ΔhflK/C strains)
Extract and process cellular proteins using standardized protocols
Perform mass spectrometry-based quantitative proteomics
Apply statistical analysis to identify significantly changed proteins
Validate direct interactions through complementary approaches
To specifically identify proteins that directly interact with FtsH in a HflK/C-dependent manner, researchers can:
Perform affinity purification of FtsH from both wild-type and ΔhflK/C strains
Analyze eluates by mass spectrometry
Compare interaction profiles to identify HflK/C-dependent binding partners
This combined approach allowed researchers to identify membrane proteins like DadA, PspC, SecY, and YlaC as potential substrates whose degradation is enhanced by HflK/C . The direct association of some differentially abundant proteins with FtsH was confirmed through the affinity purification experiments, providing strong evidence for a direct regulatory role of HflK/C .
Recombinant Haemophilus influenzae Protein HflK can be successfully expressed in E. coli as a full-length construct (amino acids 1-410) fused to an N-terminal His tag . This expression system provides good yields of functional protein suitable for structural and biochemical studies.
For optimal expression and purification, researchers should consider:
Expression vector design: Include the complete coding sequence with appropriate affinity tag (N-terminal His tag has been validated)
Expression host: E. coli has been demonstrated as an effective expression system
Purification approach: Metal affinity chromatography utilizing the His tag
Quality control: SDS-PAGE analysis can confirm purity (>90% purity is achievable)
The purified protein is typically obtained as a lyophilized powder in Tris/PBS-based buffer with 6% trehalose at pH 8.0 . For working with the purified protein, reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL . Addition of glycerol (5-50% final concentration, with 50% being optimal) is recommended for long-term storage stability .
Proper storage and handling of recombinant HflK are critical for maintaining protein integrity and functionality. Based on experimental validation, the following protocols are recommended:
Aliquoting: Divide into single-use aliquots to avoid repeated freeze-thaw cycles
Working stocks: Store working aliquots at 4°C for up to one week
Reconstitution protocol:
It is particularly important to avoid repeated freeze-thaw cycles as they significantly reduce protein stability and activity . For applications requiring native protein-protein interactions, such as structural studies of HflK/C complexes, additional considerations for maintaining quaternary structure integrity may be necessary.
For quality control during handling, greater than 90% purity as determined by SDS-PAGE should be maintained . The reconstituted protein is suitable for various applications including SDS-PAGE analysis and potentially structural studies when properly handled .
Cryo-electron microscopy (cryo-EM) has proven particularly effective for resolving the structure of HflK/C complexes. Recent studies achieved resolutions of 4.4 Å for the complete complex and 3.5 Å for specific regions through local refinement . The methodological approach involves several key considerations:
Sample preparation:
Data collection and processing:
Focused refinement strategies:
The cryo-EM data collection and processing parameters that yielded high-quality structures are summarized in the table below:
| Parameter | Primary Map | Locally Refined Map |
|---|---|---|
| Resolution (FSC 0.143) | 4.4 Å | 3.5 Å |
| Pixel size | 0.654 Å | 0.654 Å |
| Symmetry | C1 (none) | C1 (none) |
| 3D-FSC sphericity | 0.89 | 0.82 |
| Map-to-model cross-correlation | 0.69 (masked) | 0.77 (masked) |
Advanced analysis techniques such as cryoDRGN heterogeneity analysis can reveal additional structural variations, including differences in the width of the entryway into the nautilus chamber .
Mass spectrometry has proven invaluable for investigating HflK/C function through comparative proteomics and interaction studies. The optimal methodological approach involves:
Comparative proteomics workflow:
Protein interaction analysis:
This approach successfully identified approximately 2,250 proteins in E. coli, allowing classification into three categories: unchanged (88%), more abundant in ΔhflK/C (8%), and less abundant in ΔhflK/C (4%) . The differential abundance patterns provide insights into HflK/C function, while affinity purification experiments validated direct interactions with FtsH.
For meaningful data interpretation, researchers should consider both direct effects (proteins directly degraded by FtsH- HflK/C) and indirect effects (impact on transcription factors or other regulatory proteins). Validation through complementary approaches is recommended, particularly for key findings.
Proper solubilization of membrane-bound HflK/C complexes is critical for maintaining native structure and function. Based on recent structural studies, several approaches have been validated:
Detergent-based solubilization:
Detergent-free approaches:
The choice of solubilization method can impact structural outcomes, as evidenced by comparisons between natively purified and overexpressed proteins . When working with overexpressed proteins, additional factors such as chemical crosslinking or mutations may contribute to structural alterations .
For cryo-EM studies specifically, detergent concentration must be carefully optimized to avoid interference with particle visualization while maintaining protein stability. The consistency of structural features across different solubilization methods (DDM vs. GDN) provides strong validation of the nautilus-like configuration as representing the native state .
Several promising research directions emerge from recent structural and functional studies of HflK:
Substrate selectivity mechanisms: Investigate how HflK/C enhances degradation of certain membrane proteins while potentially protecting others . This would involve targeted studies of identified substrates like DadA, PspC, SecY, and YlaC to determine recognition features.
Dynamic structural transitions: Explore potential conformational changes in the nautilus-like assembly during substrate recruitment and processing . Time-resolved cryo-EM or molecular dynamics simulations could provide insights into these dynamics.
Membrane remodeling function: Further characterize the membrane curvature induced by HflK/C and its relationship to lipid scramblase activity . This phenomenon may represent a previously unrecognized function of this protein complex.
Evolutionary conservation: Examine structural and functional conservation of HflK/C complexes across bacterial species and in eukaryotic organelles . This comparative approach could reveal fundamental principles of membrane protein quality control.
Therapeutic targeting: Explore the potential of HflK/C as a target for antibacterial development, given its important role in protein quality control. Disruption of the FtsH- HflK/C interaction could represent a novel antibacterial strategy.
These research directions would benefit from integration of structural biology, proteomics, and functional genetics approaches to comprehensively understand HflK/C biology.