Recombinant Haemophilus influenzae Protein psiE homolog (psiE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please include your preferred format in the order notes and we will do our best to fulfill your needs.
Lead Time
Delivery times may vary depending on your location and purchasing method. Please consult your local distributor for the most accurate delivery information.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance as additional fees may apply.
Notes
Repeated freezing and thawing should be avoided. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
The shelf life of our proteins is influenced by various factors including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please communicate your preference to us and we will prioritize fulfilling your request during development.
Synonyms
psiE; NTHI0856; Protein PsiE homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-139
Protein Length
full length protein
Species
Haemophilus influenzae (strain 86-028NP)
Target Names
psiE
Target Protein Sequence
MEESLELEKLPRIITDVLKIVLCTALIALAIVLIIALVKITYTLSMMVLNTSSVVPYDVA EQAVMFFLYFGFIGLIVQYFKSGYHFPLRYFIYAGITAMLRLIIVNHESSVDTILFAGAI LIMVIALCLVLYSNKLKNI
Uniprot No.

Target Background

Database Links

KEGG: hit:NTHI0856

Protein Families
PsiE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Haemophilus influenzae and why is it significant for protein research?

Haemophilus influenzae is a common inhabitant of the upper respiratory tract that can cause serious infections of mucosal surfaces. This gram-negative bacterium has been extensively studied due to its pathogenic properties and the unique proteins it produces that contribute to its virulence. The bacterium possesses copious amounts of surface-localized phosphomonoesterase activity, which is mediated by bacterial lipoproteins such as protein e (P4) . Understanding these proteins is crucial for developing targeted therapies and vaccines against H. influenzae infections.

What challenges exist in purifying bacterial membrane proteins like psiE homologs?

The purification of bacterial membrane proteins, including psiE homologs, presents significant challenges primarily due to their N-terminal lipid modifications. These modifications cause the proteins to be tightly anchored to the bacterial membrane, preventing the purification of large amounts of protein for structural and functional studies . Researchers have found that the presence of these lipid modifications interferes with standard purification protocols, necessitating alternative approaches. The hydrophobic nature of these modifications also affects protein solubility and stability during the purification process.

How does recombinant DNA technology overcome traditional purification limitations?

Recombinant DNA technology offers an elegant solution to the challenges of purifying lipid-modified bacterial proteins by:

  • Replacing the N-terminal lipid modification signal sequence with one for protein secretion without such modification

  • Placing expression of the protein under the control of inducible promoters (such as T7-inducible promoter)

  • Enabling high-level expression in controlled laboratory conditions

  • Allowing for the addition of purification tags that facilitate isolation

This approach has been successfully demonstrated with H. influenzae proteins, where high levels of phosphomonoesterase activity were achieved after IPTG induction, and the target protein was purified to apparent homogeneity using just two chromatography steps . The recombinant enzyme was easily extracted from the bacterial membrane and retained properties similar to the wild-type protein.

What variables should be controlled when designing experiments with recombinant bacterial proteins?

When designing experiments involving recombinant bacterial proteins like psiE homologs, researchers must carefully control multiple variables to ensure valid and reproducible results:

Independent Variables:

  • Expression system (plasmid type, host strain)

  • Induction conditions (inducer concentration, temperature, time)

  • Buffer composition during purification

  • Protein concentration

Dependent Variables:

  • Protein yield

  • Enzymatic activity

  • Structural integrity

  • Binding affinity

Extraneous Variables to Control:

  • Bacterial growth phase

  • Contamination with host proteins

  • Post-translational modifications

  • Storage conditions affecting stability

The experimental design should involve systematic manipulation of independent variables while carefully measuring outcomes through dependent variables. This requires identifying potential confounding variables and implementing controls to minimize their impact on results.

How should researchers approach optimization of expression systems for recombinant H. influenzae proteins?

Optimization of expression systems for recombinant H. influenzae proteins requires a methodical approach:

  • Promoter Selection: Choose between constitutive or inducible promoters based on protein toxicity and desired expression levels. The T7-inducible promoter system has shown success with H. influenzae proteins .

  • Signal Sequence Engineering: Replace native lipid modification signals with secretion signals appropriate for the host expression system to facilitate purification.

  • Codon Optimization: Adjust codon usage to match the preferred codons of the expression host to enhance translation efficiency.

  • Expression Host Selection: Test multiple host strains to identify those that provide optimal folding environments and minimize proteolytic degradation.

  • Induction Conditions Matrix:

ParameterTest RangeOptimal Conditions*
IPTG Concentration0.1-2.0 mM0.5-1.0 mM
Temperature16-37°C25-30°C
Induction Time2-24 hours4-6 hours
OD600 at Induction0.4-1.00.6-0.8

*Optimal conditions vary by specific protein and must be determined experimentally

Each optimization step should be performed sequentially, testing one variable at a time while holding others constant to determine the effect of each parameter on protein yield and activity.

What chromatography methods are most effective for purifying recombinant H. influenzae proteins?

Based on published research, a combination of chromatography techniques has proven effective for purifying recombinant H. influenzae proteins:

  • Initial Capture: Ion exchange chromatography (typically anion exchange) serves as an effective first step by exploiting the charge characteristics of the target protein.

  • Intermediate Purification: Gel filtration chromatography provides separation based on molecular size while simultaneously allowing buffer exchange. This technique has been particularly useful for recombinant H. influenzae proteins that, without lipid modifications, partition effectively within the matrix of gel filtration resins .

  • Polishing Step: Affinity chromatography, if appropriate tags are incorporated into the recombinant construct, can provide highly specific final purification.

A two-step purification protocol involving these techniques has been reported to achieve apparent homogeneity for recombinant H. influenzae proteins, as confirmed by SDS-PAGE analysis . The selection of specific resins and buffer conditions must be optimized for each target protein based on its unique physicochemical properties.

How can researchers verify the structural and functional integrity of purified recombinant proteins?

Verification of structural and functional integrity requires multiple complementary approaches:

  • Structural Verification:

    • SDS-PAGE to confirm molecular weight

    • Mass spectrometry for primary structure confirmation

    • Circular dichroism spectroscopy for secondary structure analysis

    • Thermal shift assays to assess protein stability

  • Functional Verification:

    • Enzyme activity assays (e.g., phosphomonoesterase activity for P4-like proteins)

    • Substrate specificity profiling

    • pH optimum determination

    • Inhibitor sensitivity testing

For H. influenzae phosphomonoesterase proteins, physicochemical characterization has typically included comparing the recombinant protein to wild-type protein in terms of SDS-PAGE-derived molecular weight, primary structure, substrate specificity, pH optimum, and sensitivity or resistance to various inhibitors . This comprehensive approach ensures that the recombinant protein maintains native-like properties despite modifications made to facilitate expression and purification.

What approaches can be used to study the enzymatic activity of recombinant phosphomonoesterases?

Studying the enzymatic activity of recombinant phosphomonoesterases from H. influenzae requires specialized approaches:

  • Substrate Panel Analysis: Test the enzyme against a diverse panel of phosphorylated substrates to determine specificity patterns. Common substrates include p-nitrophenyl phosphate, various phosphorylated sugars, and physiologically relevant compounds.

  • Kinetic Parameter Determination: Measure reaction rates at varying substrate concentrations to calculate Km, Vmax, and kcat values, providing insights into enzyme efficiency and substrate preference.

  • pH-Activity Profiling: Determine the pH optimum by measuring activity across a range of buffer conditions, typically pH 3-10.

  • Inhibition Studies: Test various inhibitors to characterize the active site and compare with wild-type enzyme sensitivity patterns .

The data from these studies can be represented in activity graphs showing the relationship between enzyme activity and variables such as substrate concentration, pH, or inhibitor concentration. These methodologies provide critical information about the functional properties of the recombinant protein compared to its native counterpart.

How can researchers design experiments to elucidate the biological role of psiE homologs in H. influenzae?

Designing experiments to understand the biological role of psiE homologs requires an integrated approach combining genetic, biochemical, and physiological methods:

  • Gene Knockout Studies:

    • Create precise deletion mutants using homologous recombination

    • Assess phenotypic changes in growth, survival, and virulence

    • Complement mutants with wild-type or modified genes to confirm specificity

  • Protein Localization:

    • Use fluorescently tagged constructs to determine subcellular localization

    • Perform cellular fractionation followed by immunoblotting

    • Assess membrane association patterns with and without lipid modifications

  • Interaction Partners:

    • Conduct pull-down assays using the purified recombinant protein

    • Perform bacterial two-hybrid screens to identify protein-protein interactions

    • Validate interactions using co-immunoprecipitation from native bacterial lysates

  • In vivo Infection Models:

    • Compare virulence of wild-type and mutant strains in appropriate animal models

    • Assess colonization efficiency and persistence

    • Measure host immune responses to wild-type versus mutant strains

Each experimental approach should be designed with appropriate controls as outlined in standard experimental design principles, including negative controls, positive controls, and proper randomization of experimental units .

What strategies can address poor expression yields of recombinant H. influenzae proteins?

Poor expression yields of recombinant H. influenzae proteins can be addressed through several strategic approaches:

  • Expression Vector Optimization:

    • Try different promoter strengths

    • Optimize ribosome binding sites

    • Test various fusion tags (e.g., MBP, SUMO) that enhance solubility

  • Host Strain Selection:

    • Use strains with rare codon supplementation

    • Test strains with reduced protease activity

    • Consider strains with enhanced folding capacity (e.g., containing chaperone plasmids)

  • Culture Conditions Adjustment:

    • Reduce induction temperature (16-25°C)

    • Use enriched media formulations

    • Implement fed-batch cultivation strategies

  • Co-expression Strategies:

    • Co-express with molecular chaperones

    • Co-express with protein-specific binding partners

    • Include folding modulators in the culture medium

Each strategy should be systematically evaluated, and combinations of approaches may yield synergistic improvements in expression yields.

How can researchers overcome protein aggregation issues during purification?

Protein aggregation during purification is a common challenge that can be addressed through multiple strategies:

  • Buffer Optimization:

    • Screen various buffer compositions (pH, ionic strength)

    • Test different stabilizing additives (glycerol, arginine, trehalose)

    • Include mild non-ionic detergents for membrane-associated proteins

  • Purification Protocol Modifications:

    • Maintain low protein concentrations throughout the process

    • Reduce purification temperature (4°C when possible)

    • Minimize sample manipulation and concentration steps

  • Addition of Solubility Enhancers:

    • Include specific metal ions if required for proper folding

    • Add reducing agents for proteins with cysteine residues

    • Consider osmolytes that promote native state stability

  • Refolding Approaches:

    • Implement on-column refolding protocols

    • Use step-wise dialysis to gradually remove denaturants

    • Explore rapid dilution techniques with optimized refolding buffers

For H. influenzae proteins, the loss of N-terminal lipid modification has been shown to improve extraction from bacterial membranes and partition behavior within chromatography resins, suggesting that engineering constructs without these modifications can significantly reduce aggregation issues .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.