Recombinant Haemophilus influenzae Protein tolQ (tolQ)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.

Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.

Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.

The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.

Synonyms
tolQ; HI_0385; Tol-Pal system protein TolQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-228
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
tolQ
Target Protein Sequence
MTAELNFLDLFLKASIVVQLVIVILISFSIISWAIIIQRSRILTNALKEARTFEDRFWSG EDLNKLYEGLSNRRDGLTGSEQIFCVGFKEFSRLKQVNPDAPEAIIKGTMRAMNLAMNRE IESLENRVPFLATVASVSPYIGLFGTVWGIMHAFMALSGAKQATLQMVAPGIAEALIATA IGLFAAIPAVMAYNRLSLRVNAIEQDYGNFIDEFTTILHRQAFGKAPH
Uniprot No.

Target Background

Function

Recombinant Haemophilus influenzae TolQ protein is a component of the Tol-Pal system. This system plays a crucial role in outer membrane invagination during cell division and is essential for maintaining outer membrane integrity.

Database Links

KEGG: hin:HI0385

STRING: 71421.HI0385

Protein Families
ExbB/TolQ family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Haemophilus influenzae Protein tolQ and what is its function?

The Haemophilus influenzae Protein tolQ is a cytoplasmic membrane protein that forms part of the Tol-Pal system. This system plays a crucial role in the transport of colicins and phages across the bacterial cell envelope . TolQ shows significant homology with the Escherichia coli TolQ protein, exhibiting approximately 67% amino acid sequence identity . The protein is encoded by the tolQ gene, which is part of a gene cluster that includes tolR, tolA, tolB, and the P6 lipoprotein gene .

Functionally, TolQ is involved in maintaining cell envelope integrity and may play a role in cell division processes. Research in E. coli has shown that TolQ interacts with the divisome protein FtsN, suggesting its involvement in bacterial cell division mechanisms .

How is the tolQ gene organized in the Haemophilus influenzae genome?

The tolQ gene in Haemophilus influenzae is part of a gene cluster that includes tolQ, tolR, tolA, and tolB, followed by the P6 lipoprotein gene . This organization suggests that these genes may function as an operon. Specifically:

  • The translational stop codon of tolB (the last gene in the cluster) is positioned 23 bases upstream of the start codon of the P6 lipoprotein gene

  • Primer extension and Northern blot analysis have revealed that the start of the P6 transcript is located within the tolB gene

  • Nucleotide sequence analysis of the entire tolQRABP6 region shows a transcriptional terminator immediately downstream of the P6 gene

This genetic organization provides evidence that the tolQRABP6 gene cluster of H. influenzae may constitute an operon, suggesting coordinated expression of these genes .

What experimental approaches are most effective for studying TolQ function in bacterial systems?

Several experimental approaches can be employed to study TolQ function:

  • Gene Deletion Studies: Creating nonpolar deletions of individual genes encoding the cytoplasmic membrane-associated components (TolQ, TolR, TolA) can reveal phenotypic changes. For example, deletion of these genes in E. coli resulted in a phenotype where cells chain when grown under low-salt conditions .

  • Protein Overexpression Studies: Overexpression of TolQ using arabinose-regulated plasmid systems (such as pBAD18-Cm derivatives) can provide insights into its function. Researchers have observed that overexpression of TolQ results in a distinctive phenotype where cells occur as elongated rods coupled in long chains when grown under normal salt conditions .

  • Two-Hybrid Analysis: For studying protein-protein interactions, bacterial two-hybrid systems can be employed. This approach has been used to demonstrate direct interactions between specific domains of TolQ and FtsN. For example:

    • Regions encoding "bait" domains of TolQ can be cloned into plasmids like pBT to generate in-frame fusions with a gene encoding the lambda cI protein

    • Similarly, regions encoding "target" domains of potential interaction partners can be cloned into plasmids like pTRG

    • The experimental setup successfully identified that the amino-terminal domain of TolQ specifically associated with the periplasmic domain of FtsN

  • Western Blot Analysis: Using monospecific polyclonal antibodies raised against synthetic peptides corresponding to TolQ residues can help detect and quantify the protein in various experimental conditions .

How does TolQ overexpression affect bacterial cell division, and what mechanisms underlie this phenomenon?

Overexpression of TolQ in bacterial systems produces a striking phenotype with significant implications for cell division processes:

  • Observed Phenotype: When TolQ is overexpressed in E. coli, cells exhibit an elongated rod morphology and form long chains when grown under normal salt conditions . This phenotype resembles that observed in cells depleted for the essential cell division protein FtsN .

  • Specificity of Effect: Interestingly, neither TolR nor TolA overexpression produces a similar phenotype, nor is the presence of either protein required for the TolQ-dependent phenotype . This suggests a specific role for TolQ in cell division that is independent of its known partners in the Tol-Pal system.

  • Mechanism of Action: Experimental evidence suggests that overexpressed TolQ sequesters FtsN, depleting this essential protein from the divisome during Gram-negative cell division . This is supported by:

    • The observation that concomitant overexpression of FtsN rescues the TolQ-dependent phenotype

    • Two-hybrid analysis demonstrating that the amino-terminal domain of TolQ specifically associates with the periplasmic domain of FtsN in vivo

  • Experimental Verification: The sequestration model was verified by demonstrating that concurrent overexpression of FtsN alleviates the division defect caused by TolQ overexpression .

This relationship between TolQ and FtsN reveals a potential regulatory mechanism in bacterial cell division and suggests that the Tol-Pal system may have previously unrecognized roles in divisome function.

What is the optimal experimental design for studying TolQ interactions with divisome components?

When investigating TolQ interactions with divisome components, a combination of experimental approaches provides the most robust results:

  • Bacterial Two-Hybrid Analysis: This system effectively demonstrates direct protein-protein interactions. For studying TolQ:

    • Create domain-specific constructs of TolQ fused to a reporter system (e.g., lambda cI)

    • Generate corresponding constructs of potential interaction partners (e.g., FtsN) fused to another reporter component (e.g., RNA polymerase α-subunit)

    • Test interactions between specific domains to identify interaction interfaces

  • Genetic Rescue Experiments: These provide functional evidence for protein interactions:

    • Establish a phenotype through overexpression of one protein (e.g., TolQ)

    • Attempt to rescue this phenotype through concurrent expression of potential interaction partners (e.g., FtsN)

    • The successful rescue supports a functional relationship between the proteins

  • Controlled Expression Systems: Using arabinose-regulated plasmids (such as pBAD derivatives) allows for precise control of protein expression levels, which is critical for observing dose-dependent effects and preventing toxicity .

  • Control Groups: For robust experimental design:

    • Include vector-only controls

    • Test effects of overexpression of related proteins (e.g., TolR, TolA) to establish specificity

    • Verify protein expression levels through Western blot analysis

This multi-faceted approach combines genetic, biochemical, and cellular methods to provide comprehensive evidence for protein interactions and their functional significance.

What are the recommended protocols for expressing and purifying recombinant Haemophilus influenzae TolQ protein?

For successful expression and purification of recombinant Haemophilus influenzae TolQ protein, the following protocol is recommended based on established methodologies:

  • Expression System:

    • Use E. coli as the expression host for recombinant H. influenzae TolQ production

    • Express the full-length protein (amino acids 1-228) with an N-terminal His tag for purification purposes

    • Utilize a controlled expression system (such as arabinose-inducible promoters) to manage expression levels, as TolQ overexpression can affect cell morphology

  • Purification Approach:

    • Purify the His-tagged protein using standard affinity chromatography methods

    • Aim for purity greater than 90% as determined by SDS-PAGE analysis

    • The final product can be prepared as a lyophilized powder for stability

  • Reconstitution and Storage:

    • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • For long-term storage, add glycerol to a final concentration of 5-50% (with 50% being optimal) and store at -20°C/-80°C in aliquots

    • For working aliquots, store at 4°C for up to one week, as repeated freeze-thaw cycles can compromise protein integrity

    • Buffer composition: Tris/PBS-based buffer containing 6% Trehalose, pH 8.0

  • Quality Control:

    • Verify protein identity through Western blot analysis using monospecific antibodies

    • Confirm protein functionality through interaction studies with known binding partners (e.g., FtsN)

    • Assess purity via SDS-PAGE and potentially mass spectrometry

What challenges are associated with recombinant TolQ expression and how can they be overcome?

Expression of recombinant TolQ presents several challenges that researchers should anticipate and address:

  • Membrane Protein Expression Difficulties:

    • TolQ is a membrane protein with multiple transmembrane domains, which typically present challenges for expression and folding

    • Solution: Use specialized E. coli strains designed for membrane protein expression; consider fusion tags that enhance solubility while maintaining native structure

  • Growth Inhibition Effects:

    • Even moderate overexpression of TolQ can hinder the growth of E. coli strains in both fluid and solid phase cultures

    • Solution: Utilize tightly regulated expression systems with inducible promoters, and optimize induction conditions (concentration of inducer, temperature, duration)

  • Cell Division Disruption:

    • TolQ overexpression results in cells with elongated morphology, similar to FtsN-depleted cells

    • Solution: Co-express FtsN when producing TolQ at high levels, as this has been shown to rescue the division phenotype

  • Protein Stability Concerns:

    • Membrane proteins often have stability issues once extracted from their native environment

    • Solution: Include appropriate detergents in purification buffers; consider stabilizing additives such as trehalose (6%) in storage buffers ; avoid repeated freeze-thaw cycles by storing working aliquots at 4°C and long-term stocks at -20°C/-80°C with glycerol

How can researchers effectively study TolQ interactions with other proteins in the Tol-Pal system?

To study TolQ interactions with other Tol-Pal system proteins, researchers should employ a multi-faceted approach:

  • Domain-Specific Two-Hybrid Analysis:

    • Create constructs that express specific domains of TolQ and potential interaction partners

    • For TolQ, consider creating constructs for domains spanning residues 1-19, 39-135, 157-174, and 194-230, as these represent functionally distinct regions

    • For interaction partners, create corresponding constructs of their functional domains

    • Use these in bacterial two-hybrid systems to map interaction interfaces with high precision

  • Co-immunoprecipitation Studies:

    • Use antibodies raised against specific epitopes of TolQ (such as residues 47-62) for immunoprecipitation

    • Identify co-precipitating proteins through Western blot analysis or mass spectrometry

    • This approach can validate interactions in a native or near-native context

  • Genetic Deletion Studies:

    • Create nonpolar deletions of individual genes in the Tol-Pal system

    • Examine the effects on protein complexes and cellular phenotypes

    • This approach has revealed that deletion of TolQ, TolR, or TolA produces similar phenotypes under low-salt conditions

  • Competitive Binding Assays:

    • Express multiple potential binding partners of TolQ and assess competition for binding

    • This approach can help establish hierarchies of interaction strength and binding preferences

What experimental approaches can elucidate the role of TolQ in bacterial cell envelope integrity?

To investigate TolQ's role in bacterial cell envelope integrity, the following experimental approaches are recommended:

  • Gene Deletion and Complementation:

    • Create precise, complete deletions of the tolQ gene using molecular techniques

    • Observe resulting phenotypes related to membrane integrity (e.g., sensitivity to detergents, altered outer membrane properties)

    • Complement the deletion with wild-type and mutant versions of tolQ to identify critical functional domains

  • Stress Response Assays:

    • Subject wild-type and tolQ-deficient cells to various stressors (osmotic shock, detergents, antibiotics)

    • Quantify survival rates, morphological changes, and membrane permeability

    • These assays can reveal the specific aspects of envelope integrity that depend on TolQ function

  • Membrane Fractionation Studies:

    • Separate inner and outer membranes from wild-type and tolQ-mutant strains

    • Analyze protein and lipid composition of each fraction

    • Identify changes in membrane components that might explain integrity defects

  • Experimental Design Considerations:

    • Employ time series designs to track changes in envelope properties over time

    • Use quasi-experimental approaches comparing wild-type and mutant strains under identical conditions

    • Consider combining longitudinal designs with experimental manipulations for maximum insight

For robust experimental design, researchers should:

  • Randomly assign samples where possible to minimize bias

  • Include appropriate control groups to rule out alternative explanations

  • Maintain experimental control of all variables except the one being tested

How conserved is the tolQ gene and TolQ protein across bacterial species, and what does this reveal about its evolutionary significance?

The conservation of tolQ across bacterial species provides important insights into its evolutionary significance:

  • Sequence Conservation:

    • The H. influenzae TolQ protein shows 67% amino acid sequence identity with E. coli TolQ

    • This high degree of conservation between distantly related bacterial species suggests strong selective pressure to maintain TolQ function

  • Genomic Organization Conservation:

    • The organization of the tolQRAB genes as a potential operon is conserved between H. influenzae and E. coli

    • This conservation of gene arrangement suggests the importance of coordinated expression of these genes

  • Functional Conservation:

    • Both H. influenzae and E. coli TolQ proteins are involved in colicin and phage transport across the cell envelope

    • In E. coli, TolQ has been shown to interact with divisome components, particularly FtsN

    • The conservation of these functions across species highlights the fundamental importance of TolQ in bacterial physiology

To study evolutionary conservation experimentally, researchers could:

  • Perform complementation studies to determine if TolQ from one species can functionally replace TolQ in another

  • Create chimeric proteins to identify which domains are functionally interchangeable

  • Use comparative genomics to identify patterns of co-evolution between TolQ and its interaction partners

How might TolQ be targeted in antimicrobial development, and what research approaches can assess its potential as a drug target?

TolQ's essential role in bacterial envelope integrity makes it a potential target for antimicrobial development:

  • Target Validation Approaches:

    • Assess whether partial inhibition of TolQ (rather than complete deletion) affects bacterial viability

    • Determine whether TolQ inhibition produces synergistic effects with existing antibiotics

    • Evaluate whether targeting TolQ affects both actively dividing and dormant bacterial cells

  • Identification of Inhibitory Compounds:

    • Develop high-throughput screens based on TolQ-FtsN interactions using two-hybrid systems

    • Screen compound libraries for molecules that disrupt protein-protein interactions without general cytotoxicity

    • Focus on compounds that target the amino-terminal domain of TolQ, which has been shown to interact with the periplasmic domain of FtsN

  • Experimental Design Considerations:

    • Use randomized screening approaches to minimize bias in compound selection

    • Include appropriate control groups (untreated, vehicle-treated) in all experiments

    • Employ time series designs to track the development of resistance to TolQ-targeting compounds

  • Resistance Development Assessment:

    • Study the frequency of spontaneous resistance to TolQ inhibitors

    • Characterize mechanisms of resistance through genetic and biochemical approaches

    • Evaluate the fitness cost of resistance mutations in various environmental conditions

This research approach combines basic science understanding of TolQ function with applied research in drug development, potentially leading to novel antimicrobial strategies targeting bacterial cell envelope integrity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.