Recombinant Haemophilus influenzae Protein translocase subunit SecD (secD)

Shipped with Ice Packs
In Stock

Description

Biological Role in the Sec Translocase System

The SecD subunit is part of the SecYEG-SecDF-YajC-YidC holo-translocon, a multi-protein complex essential for:

  • Post-translocational completion: SecD works with SecF to utilize the proton motive force (PMF) for final protein translocation after ATP-dependent SecA activity .

  • Membrane protein insertion: Critical for integrating outer membrane proteins and virulence factors in H. influenzae .

Key Interactions

  • SecA: ATPase motor driving preprotein translocation .

  • SecY/SecE: Core channel components forming the translocation pore .

  • YidC/YajC: Assist in membrane protein folding and assembly .

Mechanistic Studies

  • Investigates Sec translocase dynamics in H. influenzae .

  • Used to dissect PMF-dependent steps in protein secretion .

Pathogenicity and Virulence

  • The Sec system is implicated in exporting virulence factors (e.g., adhesins, proteases) . Studies suggest recombination events in Sec-associated genes (e.g., secE) may enhance bacterial adaptation during infection .

Antibiotic Development

  • SecD is a potential target for disrupting protein export in H. influenzae, a pathogen causing respiratory infections and meningitis .

Functional Data from Experimental Studies

  • Biofilm Formation: Competence-induced DNA release in H. influenzae relies on TraCG and Sec-related systems, highlighting the broader role of secretion in biofilm maturation .

  • Genetic Recombination: Genomic analysis of H. influenzae serotype f revealed recombination hotspots near secE, emphasizing the evolutionary flexibility of Sec-associated genes .

Future Research Directions

  • Structural Resolution: Cryo-EM studies to map SecD’s role in the holo-translocon.

  • Inhibitor Screening: Identify compounds targeting SecD’s PMF-binding domains.

  • Role in Virulence: Elucidate SecD’s contribution to H. influenzae pathogenesis using knockout models.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we understand you may have specific requirements. Please indicate your preferred format in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery estimates, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, it is recommended to briefly centrifuge the vial prior to opening to ensure all contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. Adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C is recommended. Our standard protocol utilizes a final glycerol concentration of 50%, which can serve as a reference point for your preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. To ensure optimal preservation, aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize the development of your desired tag type.
Synonyms
secD; HI_0240; Protein translocase subunit SecD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-616
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
secD
Target Protein Sequence
MLNRYPLWKNLMVIFIVAIGILYSLPNIYGEDPAVQISGTRGQEANTSVLGQVQDVLKTN NLPTKSIVLENGSILARFTNTDDQLLAKDKIAERLGNNYTTALNLAPATPAWLSMFGANP MKWGLDLRGGVRFLMEVDMNATLVKRQEQLQDSLRGELRKEKIQYTAIKNTEHFGTLITL ANVSQRAKAERIIRQLHPTLDITEPDADSINLGLSTAALNEARDLAIEQNLTILRKRVAE LGVAEAVIQRQGAERIVIELPGVQDTARAKEILGATATLEFRIVNQNVTADAISRNMLPA DSEVKYDRQGHPVALFKRAVLGGEHIINSSSGLDQHSSTPQVSVTLDSEGGEIMSQTTKK YYKKPMATLYVEYKDNGKKDENGKTILEKHEEVINVATIQGRFGSNFQITGVDSIAEAHN LSTLLKSGALIAPIQIVEERTIGPSLGAQNVEQGINASLWGLVAVIAFMLFYYKMFGVIA SFALVINIVLLVGLMSILPGATLSMPGIAGIVLTLGMSVDANVLIFERIKEEIRNGRSIQ QAINEGYNGAFTSIFDANLTTILTAIILYAVGTGPIQGFAITLSLGVAISMFTAITGTRA LVNALYGGKQLKKLLI
Uniprot No.

Target Background

Function
SecD is a component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation after the ATP-dependent function of SecA.
Database Links

KEGG: hin:HI0240

STRING: 71421.HI0240

Protein Families
SecD/SecF family, SecD subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of SecD in Haemophilus influenzae?

SecD functions as an essential component of the bacterial Sec translocase system, which is responsible for protein translocation across the cytoplasmic membrane in H. influenzae. As part of the SecDF complex, it works in conjunction with the SecYEG translocon to facilitate protein export using the proton motive force. The SecD subunit enhances the efficiency of protein translocation by preventing backward movement of partially translocated proteins. In the context of H. influenzae pathogenesis, functional protein secretion systems are critical for bacterial survival and virulence in host environments.

How does SecD differ structurally from other protein translocase components in H. influenzae?

SecD in H. influenzae is a membrane protein with multiple transmembrane domains and periplasmic loops that distinguish it from other Sec components. Unlike the channel-forming SecY or the ATPase SecA, SecD functions primarily in the late stages of translocation. It contains periplasmic domains that are considerably larger than those found in SecF, allowing for interaction with substrates emerging from the SecYEG channel. In H. influenzae specifically, the periplasmic domains of SecD exhibit structural features that may be adapted to the unique protein secretion requirements of this pathogen, though detailed crystallographic studies of H. influenzae SecD are still limited compared to homologs from other bacteria.

What are the optimal purification strategies for recombinant H. influenzae SecD?

The purification of recombinant H. influenzae SecD requires a carefully designed protocol addressing its membrane protein nature. The most effective strategy typically involves:

  • Initial solubilization using mild detergents (n-dodecyl-β-D-maltoside or digitonin)

  • Affinity chromatography using nickel-NTA resin (for His-tagged constructs)

  • Size exclusion chromatography for further purification

Critical parameters to monitor include:

ParameterRecommended RangeNotes
Detergent concentration1-2% for extraction; 0.05-0.1% for purificationHigher concentrations risk protein denaturation
NaCl concentration150-300 mMHelps maintain protein stability
pH7.2-8.0Optimal for maintaining SecD structure
Glycerol content10-20%Prevents aggregation during concentration

The addition of lipids during or after purification can significantly enhance stability and activity of the purified SecD protein by providing a native-like membrane environment.

How can researchers effectively measure the functionality of purified recombinant H. influenzae SecD?

Functionality assessment of purified H. influenzae SecD should employ multiple complementary approaches:

  • ATPase activity assays: While SecD itself is not an ATPase, it enhances the ATPase activity of SecA in the complete translocase complex. Measuring ATP hydrolysis rates in reconstituted systems can indirectly assess SecD function.

  • Proton transport assays: As SecD utilizes the proton motive force, researchers can measure proton transport using pH-sensitive fluorescent dyes in proteoliposomes containing reconstituted SecD.

  • In vitro translocation assays: Using purified components (SecA, SecYEG, SecDF) and radiolabeled model substrates to measure translocation efficiency into proteoliposomes.

  • Complementation assays: Testing the ability of recombinant SecD to restore function in conditional secD mutants of H. influenzae or E. coli.

For reliable results, positive controls using E. coli SecD (with established activity parameters) and negative controls using inactive SecD mutants should be included in all functional assessments.

What are the main challenges in crystallizing H. influenzae SecD for structural studies?

Crystallizing H. influenzae SecD presents several significant challenges:

  • Membrane protein stability: SecD naturally exists in a lipid environment, and maintaining its native conformation outside this environment is difficult. Researchers should systematically screen detergents and lipid additives to identify optimal stabilization conditions.

  • Conformational heterogeneity: As a dynamic protein engaged in translocation, SecD may adopt multiple conformations, complicating crystallization. The addition of substrate analogs or ATP/ADP might help trap the protein in specific conformations.

  • Low expression yields: The typical yields of purified SecD are often insufficient for crystallization trials. Optimizing expression through codon optimization and testing multiple expression strains becomes essential.

  • Crystal packing interactions: The large periplasmic domain of SecD may provide crystal contacts, but the hydrophobic transmembrane regions often hinder ordered crystal formation. Techniques like lipidic cubic phase crystallization or the use of antibody fragments as crystallization chaperones may improve success rates.

Alternative approaches such as cryo-electron microscopy (cryo-EM) might circumvent some of these challenges, particularly for capturing the structure of SecD within the context of the complete Sec translocase complex.

How does SecD interact with other Sec pathway components in H. influenzae compared to other bacterial systems?

Key interaction differences include:

  • SecD-SecF interface: H. influenzae SecD appears to have modifications in the transmembrane domains that contact SecF, potentially affecting the stability of this subcomplex.

  • SecDF-SecYEG association: The periplasmic loops of H. influenzae SecD show sequence divergence in regions that likely interact with SecY, which may tune the translocase activity to H. influenzae-specific secretory proteins.

  • Interaction with accessory factors: Unlike E. coli, H. influenzae SecD may have evolved specialized interactions with periplasmic chaperones unique to this organism, reflecting its adaptation to the human host environment.

These differences likely contribute to the optimization of the Sec system for the specific secretome of H. influenzae as an obligate human pathogen .

What is the relationship between SecD function and antimicrobial resistance in H. influenzae?

The relationship between SecD function and antimicrobial resistance in H. influenzae represents an emerging area of research with significant clinical implications. Several lines of evidence suggest important connections:

  • Outer membrane protein assembly: SecD is indirectly involved in the proper localization of outer membrane proteins, including porins that control antibiotic entry. Altered SecD function could modify the outer membrane permeability barrier, affecting susceptibility to hydrophilic antibiotics .

  • Efflux pump expression: Some multidrug efflux pumps require proper membrane insertion via the Sec pathway. Modulation of SecD activity may affect the levels of functional efflux pumps in the membrane.

  • Stress response: SecD mutations in clinical isolates have been associated with altered stress responses, potentially contributing to antibiotic tolerance states.

Genomic analysis of resistant H. influenzae strains has revealed conserved sequences in secD despite considerable variability in other regions of the genome, suggesting functional constraints on this protein even under selective antibiotic pressure . This conservation makes SecD an attractive target for developing novel antimicrobials that might be less prone to resistance development.

How does the genetic diversity of secD across H. influenzae strains correlate with pathogenicity?

Comparative genomic analysis across H. influenzae strains reveals an interesting pattern of conservation and variation in the secD gene:

  • Core sequence conservation: The central functional domains of SecD show high conservation (>95% amino acid identity) across both typeable and non-typeable H. influenzae strains, reflecting the essential nature of protein translocation.

  • Strain-specific variations: Certain periplasmic loop regions of SecD exhibit higher variability, particularly in regions exposed to the periplasmic space. These variable regions could potentially interact with strain-specific secreted virulence factors.

  • Serotype correlation: SecD sequences cluster partially according to serotype, with type f strains showing distinct patterns in specific transmembrane regions compared to non-typeable strains .

The genomic analysis of bloodstream isolates indicates that secD is not typically located within the major recombination hotspots identified in the H. influenzae genome. This suggests that while the gene may undergo some adaptive evolution, massive recombination events that can drive virulence factor diversification do not commonly target secD .

What role might SecD play in H. influenzae adaptation to the human host environment?

H. influenzae SecD likely plays a critical role in the pathogen's adaptation to human host environments through its involvement in the secretion and membrane insertion of proteins necessary for survival under various stress conditions:

  • Oxidative stress response: As an obligate human pathogen, H. influenzae encounters significant oxidative stress from host immune cells. SecD-dependent translocation of peroxidases and catalases is essential for bacterial survival under these conditions.

  • Nutrient acquisition: H. influenzae is a glutathione auxotroph that requires specific transport systems for survival . SecD-mediated membrane insertion of transporters like DppBCDF (involved in glutathione import) may be crucial for nutrient acquisition in nutrient-limited host niches.

  • Immune evasion: Surface proteins involved in immune evasion must be properly localized, a process dependent on functional SecD. This includes the assembly of outer membrane structures that shield pathogen-associated molecular patterns from host recognition.

The adaptation of H. influenzae to the human respiratory tract likely involves fine-tuning of the Sec pathway to optimize the export of proteins needed in this specific environment. Research suggests that SecD function may be particularly important during infection establishment, as evidenced by transcriptomic studies showing upregulation of secD during early colonization phases.

What genetic approaches can be used to study SecD function in H. influenzae?

Several genetic approaches can be employed to investigate SecD function in H. influenzae:

  • Conditional knockdown systems: Since secD is likely essential, researchers should use inducible promoter systems (such as tetracycline-responsive elements) to create conditional knockdown strains. These allow titration of SecD levels and observation of phenotypic effects without complete lethality.

  • Site-directed mutagenesis: Strategic mutations targeting:

    • Conserved residues in the transmembrane domains

    • Periplasmic loops involved in substrate interaction

    • Regions implicated in proton translocation

  • Domain swapping experiments: Replacing specific domains of H. influenzae SecD with corresponding regions from other bacteria can identify species-specific functional elements.

  • Suppressor screens: Identifying suppressors of partial-loss-of-function secD mutations can uncover genetic interactions and compensatory pathways.

  • CRISPR interference (CRISPRi): For transient, tunable repression of secD expression without genomic modification.

The effectiveness of these approaches depends on transformation efficiency, which varies among H. influenzae strains. Non-typeable strains generally show higher natural transformation competence compared to encapsulated strains, making them more amenable to genetic manipulation .

How can researchers effectively study SecD interactions with other proteins in the Sec translocase complex?

To study SecD interactions within the complex Sec translocase machinery, researchers should employ multiple complementary approaches:

  • In vivo crosslinking: Chemical crosslinkers with different spacer arm lengths can capture transient interactions. Formaldehyde crosslinking followed by immunoprecipitation (ChIP-like approach) can identify physiologically relevant interactions.

  • Bacterial two-hybrid systems: Modified for membrane proteins, these systems can screen for interaction partners of specific SecD domains.

  • Site-specific photocrosslinking: Incorporation of photoreactive unnatural amino acids at specific positions in SecD allows precise mapping of interaction interfaces.

  • FRET-based approaches: Fluorescently labeled SecD and partner proteins can detect interactions and conformational changes in real-time.

  • Co-purification strategies: Tandem affinity purification using differentially tagged components of the Sec machinery can isolate intact complexes for compositional analysis.

  • Surface plasmon resonance: For quantitative measurement of binding kinetics between purified SecD and partner proteins.

For meaningful results, these studies should ideally be performed under conditions that maintain the native membrane environment. Nanodiscs or similar membrane mimetics provide advantages over detergent-solubilized systems for maintaining the structural integrity of membrane protein complexes.

What bioinformatic approaches are most valuable for analyzing SecD sequence and structure across H. influenzae strains?

Comprehensive bioinformatic analysis of SecD across H. influenzae strains should incorporate:

  • Comparative sequence analysis:

    • Multiple sequence alignment of SecD from diverse H. influenzae clinical isolates

    • Calculation of conservation scores at amino acid resolution

    • Identification of sequence signatures associated with specific serotypes or clinical presentations

  • Structural bioinformatics:

    • Homology modeling based on available bacterial SecD structures

    • Prediction of transmembrane topology and periplasmic domain organization

    • Molecular dynamics simulations to assess the impact of strain-specific variations

  • Evolutionary analysis:

    • dN/dS ratio calculation to identify regions under positive or purifying selection

    • Reconstruction of SecD phylogeny across H. influenzae strains

    • Detection of potential horizontal gene transfer events

  • Genome context analysis:

    • Examination of secD operon structure across strains

    • Identification of co-evolving genes that may functionally interact with SecD

These approaches can be particularly powerful when integrated with phenotypic and clinical data from the source strains, potentially revealing correlations between SecD sequence features and pathogenicity profiles or host niche adaptation .

How might targeting SecD lead to novel antimicrobial strategies against H. influenzae?

SecD represents a promising antimicrobial target against H. influenzae for several reasons:

  • Essential function: SecD is likely essential for H. influenzae viability, making it an attractive target for bactericidal compounds.

  • Surface accessibility: The large periplasmic domains of SecD may be accessible to antibiotics that can penetrate the outer membrane but not the inner membrane.

  • Unique features: H. influenzae SecD contains sequence regions distinct from human proteins, potentially allowing for selective targeting.

Potential antimicrobial strategies include:

  • Small molecule inhibitors: Compounds targeting the SecD-SecF interface or blocking the proton channel function could disrupt protein secretion.

  • Peptidomimetics: Designed to mimic natural substrates but bind irreversibly to SecD, blocking the translocation pathway.

  • Monoclonal antibodies: Targeting surface-exposed epitopes of SecD's periplasmic domain in permeabilized bacteria.

  • Adjuvant approach: SecD inhibitors could sensitize H. influenzae to existing antibiotics by disrupting the membrane protein composition necessary for maintaining permeability barriers and efflux systems.

While challenges exist in delivering compounds to the periplasmic space, the outer membrane of H. influenzae is generally more permeable than that of many gram-negative bacteria, potentially facilitating access to SecD-targeted therapeutics .

What techniques can be applied to study the kinetics of protein translocation mediated by H. influenzae SecD?

Understanding the kinetics of SecD-mediated protein translocation requires sophisticated biophysical approaches:

  • Real-time translocation assays:

    • Fluorescence spectroscopy using environmentally sensitive probes incorporated into substrate proteins

    • FRET-based measurements between substrate proteins and components of the Sec machinery

    • Single-molecule approaches to track individual translocation events

  • Electrophysiological methods:

    • Planar lipid bilayer recordings to measure ion conductance associated with SecYEG-SecDF complexes

    • Patch-clamp measurements on proteoliposomes containing reconstituted Sec components

  • Structural dynamics:

    • Time-resolved cryo-EM to capture different states of the translocation process

    • Hydrogen-deuterium exchange mass spectrometry to map conformational changes during translocation

  • Computational approaches:

    • Molecular dynamics simulations of substrate passage through the SecYEG-SecDF complex

    • Kinetic modeling of the translocation process incorporating ATP hydrolysis and proton motive force utilization

These techniques should be applied using H. influenzae-specific substrates rather than model proteins from E. coli to accurately reflect the native function of H. influenzae SecD. Comparing translocation kinetics under conditions mimicking different host environments (varying pH, oxidative stress, etc.) may provide insights into how SecD function adapts during infection.

How does H. influenzae SecD contribute to biofilm formation and persistence?

The contribution of SecD to H. influenzae biofilm formation represents an important but understudied aspect of this pathogen's biology:

  • Adhesin secretion: SecD likely facilitates the proper localization of adhesins and other surface proteins necessary for initial attachment to surfaces and host cells. Suboptimal SecD function may result in reduced surface display of these factors.

  • Matrix production: Extracellular polymeric substances (EPS) that form the biofilm matrix often require secretion systems for export. SecD may participate in the translocation of enzymes involved in EPS synthesis or modification.

  • Stress response within biofilms: Bacteria in biofilms often experience nutrient limitation and oxidative stress. SecD-dependent membrane protein insertion may be crucial for adapting to these conditions.

  • Persister cell formation: The SecD-mediated translocation efficiency could influence bacterial dormancy and persistence by affecting the membrane proteome composition.

Experimental approaches to study these connections include:

  • Comparative biofilm assays using wild-type and SecD-depleted strains

  • Microscopic examination of protein localization within biofilms using fluorescently tagged secretory proteins

  • Transcriptomic and proteomic analysis of the secretome in biofilm versus planktonic growth conditions

Understanding these relationships may reveal new strategies for disrupting H. influenzae biofilms in chronic infections, particularly in contexts like otitis media where biofilm formation contributes significantly to pathogen persistence.

What are the key unanswered questions about H. influenzae SecD that warrant further investigation?

Despite advances in understanding bacterial protein secretion, several critical questions about H. influenzae SecD remain unresolved:

  • Substrate specificity: Does H. influenzae SecD exhibit preferences for specific classes of secretory proteins that differ from other bacteria? This may reveal adaptations specific to its lifestyle as a human-restricted pathogen.

  • Regulatory mechanisms: How is SecD expression regulated in response to different host environments and stress conditions? Understanding this regulation could reveal vulnerabilities in the pathogen's adaptive responses.

  • Post-translational modifications: Are there H. influenzae-specific modifications of SecD that modulate its function during infection? Phosphorylation or other modifications might serve as regulatory switches.

  • Accessory interactions: Does H. influenzae SecD interact with unique accessory proteins not found in model organisms? Such interactions could represent species-specific adaptations to its ecological niche.

  • Conformational dynamics: What are the precise conformational changes in SecD that couple proton translocation to protein export? High-resolution structural data in different functional states is needed.

  • Host interaction: Does SecD or the SecD-dependent secretome directly influence host immune responses during H. influenzae infection?

Addressing these questions will require integrative approaches combining structural biology, genetics, biochemistry, and infection models, potentially revealing new insights into both fundamental bacterial secretion mechanisms and pathogen-specific adaptations.

How might our understanding of H. influenzae SecD inform studies of protein translocation in other bacterial pathogens?

The study of H. influenzae SecD offers valuable insights that can inform research on protein translocation across diverse bacterial pathogens:

  • Comparative analysis framework: Methodologies developed for H. influenzae SecD characterization provide templates for similar studies in other difficult-to-culture pathogens.

  • Evolutionary adaptations: Identifying how H. influenzae has modified its SecD to function optimally in human host environments may reveal parallel adaptations in other host-restricted pathogens.

  • Minimal secretion systems: As a bacterium with a relatively small genome, H. influenzae may represent a "minimal" secretion system model, highlighting the core essential components and functions.

  • Therapeutic potential: Principles learned from targeting H. influenzae SecD could inform similar approaches against other gram-negative pathogens where conventional antibiotics are increasingly ineffective.

  • Host-pathogen interface: Understanding how H. influenzae SecD contributes to the export of virulence factors may reveal common strategies used by respiratory pathogens to establish infection.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.