Recombinant Haemophilus influenzae Protein transport protein HofC homolog (hofC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
hofC; hopC; HI_0297; Protein transport protein HofC homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-406
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
hofC
Target Protein Sequence
MTKKLFYYQASNPLNQKQKGSIIADTKQQAHFQLISRGLTHIKLQQNWQFGAKPKNSEIS ELLNQLATLLQSAIPLKNSLQILQQNCTQIVLNEWLERLLQSIESGLAFSQAIEQQGKYL TQQEIQLIQVGEMTGKLAVVCKKIATHRSQSLALQRKLQKIMLYPSMVLGISLLLTLALL LFIVPQFAEMYSGNNAELPTITAILLSISNFLKQNIGILLFFVLSFFLFYYFYLKRQTWF YQKKNQLISITPIFGTIQKLSRLVNFSQSLQIMLQAGVPLNQALDSFLPRTQTWQTKKTL VNDIVLDKEVRSILQWVSQGYAFSNSVSSDLFPMEAQQMLQIGEQSGKLALMLEHIAENY QEKLNHQIDLLSQMLEPLMMVIIGSLIGIIMMGMYLPIFNMGSVIQ
Uniprot No.

Target Background

Database Links

KEGG: hin:HI0297

STRING: 71421.HI0297

Protein Families
GSP F family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structure of the HofC homolog in Haemophilus influenzae and how does it compare to similar transport proteins?

The structural characterization of HofC homolog requires combining computational prediction methods with experimental verification. While specific structural data for HofC homolog is limited, researchers can employ approaches similar to those used for other H. influenzae proteins. For instance, generating structural models using tools like AlphaFold, followed by refinement against cryo-EM reconstructions.

For structural analysis, researchers should consider:

  • Generating an initial model using sequence-based prediction software

  • Fitting the model into electron density maps if available

  • Refining the structure using programs like Coot and phenix.real_space_refine

  • Analyzing the refined structure for key domains and functional regions

The refinement process should include careful assessment of model quality parameters such as those shown below:

Quality ParameterTarget Range
R.m.s. bond lengths (Å)<0.01
R.m.s. bond angles (°)<1.0
Ramachandran favored (%)>90
Ramachandran allowed (%)<10
Ramachandran outliers (%)<1
Clashscore<15

What expression systems are most effective for producing recombinant HofC homolog protein?

For recombinant expression of H. influenzae proteins, multiple expression systems can be considered. The choice depends on research goals, required protein folding, and downstream applications.

Recommended approach:

  • Evaluate E. coli-based expression systems for initial testing due to ease of genetic manipulation

  • For proteins requiring specific post-translational modifications, consider eukaryotic expression systems

  • Optimize codon usage for the expression host to enhance protein yield

  • Include appropriate purification tags (His-tag, SNAP-tag) for downstream applications and analysis

For proteins intended for functional studies in living cells, consider generating fluorescent fusion constructs that can be microinjected into mammalian cells to track localization and function. This approach has been successfully used for studying protein transport in living cells while preserving cellular machinery .

How can researchers assess the functional integrity of recombinant HofC homolog?

Functional assessment of recombinant HofC homolog requires multiple complementary approaches:

  • In vitro transport assays: Reconstitute purified protein in liposomes to measure transport activity

  • Genetic complementation: Test if the recombinant protein can restore function in hofC-deficient strains

  • Cell-based assays: Evaluate the impact on colonization, adherence, or invasion capabilities when the protein is present versus absent

  • Microinjection approach: Deliver fluorescently tagged protein directly into cells to observe real-time localization and function

For quantitative assessment of protein function, researchers should establish clear metrics such as transport rates, binding affinities, or cellular phenotypes that can be measured in a standardized manner. This allows for comparison between wild-type and mutant variants of the protein.

How does HofC homolog contribute to H. influenzae pathogenesis and colonization of respiratory epithelial cells?

Understanding HofC homolog's role in pathogenesis requires examining its function in the context of host-pathogen interactions. While specific data on HofC is limited in the provided search results, approaches used for studying other H. influenzae proteins can be adapted.

Recommended methodological approach:

  • Generate hofC knockout strains using targeted gene deletion techniques

  • Compare wild-type and knockout strains in respiratory epithelial cell attachment and invasion assays

  • Assess the impact on biofilm formation capabilities

  • Evaluate bacterial persistence in airway infection models

Similar to studies with other H. influenzae proteins, researchers should consider both in vitro cell culture models and in vivo animal models. For example, studies examining the HMW1 adhesin demonstrated its crucial role in epithelial cell invasion, with transformants expressing this protein showing ~1,000-fold increased invasion into airway epithelial cells .

What techniques can be used to study the real-time dynamics of HofC homolog transport function in living cells?

Studying real-time protein dynamics presents significant challenges but offers valuable insights into protein function. Based on methodologies developed for other transport proteins, researchers can apply several approaches:

  • Microinjection of fluorescent reporter proteins: Develop a gentle microinjection procedure to deliver fluorescently tagged HofC homolog into cells, allowing direct non-invasive study of its localization and transport function in real-time

  • Live-cell imaging with selective inhibitors: Apply specific inhibitors of transport processes during imaging to assess functional dependencies

  • FRAP (Fluorescence Recovery After Photobleaching): Measure the mobility and turnover rates of the tagged protein in membrane environments

When implementing the microinjection approach, attention to procedural details is crucial to preserve cellular function. The protocol should be designed to minimize cell damage while ensuring efficient protein delivery. This approach has been successfully used to study other transport proteins without compromising cellular integrity or transport machinery function .

How do environmental conditions affect the expression and function of HofC homolog in H. influenzae?

Environmental responsiveness of transport proteins often reflects their role in bacterial adaptation. To investigate how HofC homolog responds to different conditions:

  • Transcriptional analysis: Monitor hofC expression under varying conditions (oxygen levels, nutrient availability, pH) using qPCR or RNA-seq

  • Protein abundance studies: Use quantitative proteomics to measure protein levels under different conditions

  • Structure-function studies: Examine if environmental factors alter protein conformation or activity

  • Host factor interaction studies: Determine if specific host factors (like heme availability) influence expression or function

Research into other H. influenzae proteins has shown important environmental adaptations. For example, H. haemolyticus produces the heme-binding protein hemophilin (Hpl) that sequesters heme to protect against colonization by pathogenic non-typeable H. influenzae (NTHi). This demonstrates how competition for essential resources like heme influences bacterial interactions in the respiratory tract .

What methodologies can be employed to identify interaction partners of HofC homolog in the H. influenzae membrane system?

Understanding protein interaction networks is essential for elucidating transport protein function. Several complementary approaches can be used:

  • Co-immunoprecipitation with mass spectrometry: Pull down HofC homolog with specific antibodies and identify binding partners

  • Bacterial two-hybrid systems: Screen for protein-protein interactions in vivo

  • Proximity labeling approaches: Use BioID or APEX2 fusion proteins to identify proteins in close proximity to HofC homolog

  • Crosslinking mass spectrometry: Capture transient interactions through chemical crosslinking

When analyzing interaction data, researchers should distinguish between stable complex components and transient interactions by performing experiments under different stringency conditions. Validation of key interactions should be performed using techniques like FRET (Förster Resonance Energy Transfer) or co-localization studies in live cells.

How can researchers utilize Transformed Recombinant Enrichment Profiling (TREP) to study HofC homolog function?

TREP offers a powerful approach to identify genetic determinants of phenotypic traits in naturally transformable bacteria like H. influenzae. This method can be adapted to study HofC homolog function:

  • Generate pools of recombinants through natural transformation with donor DNA containing hofC variants

  • Apply selective pressure relevant to HofC homolog function

  • Use deep sequencing to identify enriched genetic variants

  • Validate candidate genetic determinants through targeted mutational analysis

This approach has been successfully applied to investigate the genetic basis of intracellular invasion by H. influenzae, revealing the importance of the HMW1 adhesin. Similar methodologies could identify genetic interactions between hofC and other genes or determine the impact of specific hofC variants on bacterial phenotypes .

What structural analysis techniques are most informative for characterizing HofC homolog protein domains?

Comprehensive structural characterization requires integrating multiple techniques:

  • Cryo-electron microscopy: Generate high-resolution structural data, particularly valuable for membrane proteins

  • AlphaFold or similar prediction tools: Develop initial structural models based on sequence data

  • Molecular dynamics simulations: Study protein flexibility and conformational changes

  • Hydrogen-deuterium exchange mass spectrometry: Map solvent-accessible regions and conformational dynamics

When refining structural models, researchers should pay particular attention to quality metrics as outlined in the following table, adapted from approaches used for other protein structural studies:

Validation ParameterAcceptable RangeOptimal Range
Bond lengths RMSD (Å)<0.010<0.005
Bond angles RMSD (°)<1.50<0.70
Ramachandran favored (%)>90>95
Ramachandran outliers (%)<1.0<0.5
Rotamer outliers (%)<5.0<1.0
Clashscore<15.0<5.0
CC mask>0.80>0.85

These metrics help ensure the reliability of structural models before deriving functional hypotheses .

How can microinjection approaches be optimized for studying HofC homolog in cellular contexts?

Microinjection offers unique advantages for studying protein transport dynamics in living cells. For optimal results with HofC homolog studies:

  • Protein preparation: Express and purify recombinant HofC homolog with appropriate tags (fluorescent proteins or SNAP-tags)

  • Injection parameters:

    • Use minimal injection volumes (typically 5-10% of cell volume)

    • Maintain physiological buffer conditions

    • Control injection pressure and duration to minimize cellular stress

  • Live imaging setup:

    • Employ temperature and CO2 control for physiological conditions

    • Use low-phototoxicity imaging approaches to enable long-term observation

  • Controls:

    • Include non-functional protein variants (e.g., with point mutations in key domains)

    • Perform parallel experiments with translation inhibitors to assess impact on protein dynamics

When optimizing microinjection protocols, researchers should carefully validate that the procedure does not disrupt cellular functions or organelle morphology. Studies have shown that gentle microinjection preserves mitochondrial morphology and protein translocation machinery, suggesting it can similarly preserve other cellular transport systems .

What approaches can be used to study the competitive dynamics between H. influenzae and other microbiome members through HofC homolog function?

Understanding how HofC homolog influences interactions within the microbiome requires ecological approaches:

  • Co-culture experiments: Establish controlled mixed cultures of H. influenzae with other respiratory tract bacteria

  • Resource competition assays: Measure how HofC homolog affects acquisition of essential nutrients in mixed cultures

  • In vivo colonization models: Compare wild-type and hofC mutant strains for competitive fitness in animal models

  • Biofilm formation studies: Assess how HofC homolog influences multi-species biofilm dynamics

Research into related H. influenzae proteins has demonstrated the importance of such approaches. For example, studies with H. haemolyticus showed that its production of the heme-binding protein hemophilin significantly reduced NTHi colonization of the upper airway and impaired NTHi infection of the lungs. This protective effect was dependent on the ability to sequester heme, demonstrating how competition for essential resources shapes bacterial community dynamics .

What are common challenges in expressing and purifying recombinant HofC homolog and how can they be addressed?

Membrane protein expression and purification present specific challenges:

  • Expression issues:

    • Low expression yields due to toxicity

    • Protein misfolding or aggregation

    • Incomplete insertion into membranes

  • Purification challenges:

    • Detergent selection for membrane extraction

    • Maintaining protein stability during purification

    • Removing contaminating proteins

Recommended solutions:

  • Test multiple expression systems (bacterial, insect, mammalian)

  • Optimize induction conditions (temperature, inducer concentration, duration)

  • Screen detergents systematically for extraction efficiency and protein stability

  • Consider fusion tags that enhance solubility (MBP, SUMO)

  • Implement quality control checks at each purification stage using techniques like size-exclusion chromatography and dynamic light scattering

How can researchers reconcile conflicting data regarding HofC homolog function from different experimental approaches?

Addressing data inconsistencies requires systematic methodology:

  • Contextualization of results:

    • Examine differences in experimental conditions

    • Consider strain-specific variations in H. influenzae

    • Assess the impact of tags or fusion proteins on function

  • Validation strategies:

    • Use complementary techniques to verify key findings

    • Perform genetic complementation to confirm phenotypic observations

    • Implement controls to rule out experimental artifacts

  • Systematic approach to reconciliation:

    • Develop a unified experimental framework with standardized conditions

    • Use isogenic strains to minimize background genetic variation

    • Employ quantitative metrics to enable direct comparison between studies

When faced with contradictory results, researchers should consider developing a consensus model that integrates findings from multiple approaches while acknowledging methodological limitations.

What emerging technologies might advance our understanding of HofC homolog structure and function?

Several cutting-edge approaches hold promise for future research:

  • Cryo-electron tomography: For studying HofC homolog in its native membrane environment

  • Single-molecule techniques: To examine conformational dynamics during transport cycles

  • Advanced genetic tools: CRISPR-based approaches for precise genome editing in H. influenzae

  • Microfluidic systems: For studying bacterial responses to changing environmental conditions

  • Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics to understand system-level effects of HofC homolog function

As technical capabilities advance, researchers should focus on integrating structural insights with functional data to develop comprehensive models of how HofC homolog contributes to H. influenzae biology and pathogenesis.

How might HofC homolog research contribute to broader understanding of bacterial transport mechanisms?

Studies of HofC homolog can inform several areas of bacterial physiology:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.