Recombinant Haemophilus influenzae Putative L,D-transpeptidase HI_1667 (HI_1667)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes; we will accommodate your request to the best of our ability.
Lead Time
Delivery times vary depending on shipping method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its use in manufacturing.
Synonyms
HI_1667; Putative L,D-transpeptidase HI_1667
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-489
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
HI_1667
Target Protein Sequence
MVVFKSTLKLSLFALSLSMMMSGCVLVGLSKNDQSKSLYGINLSHLSLAERKELEEAIYA DQQRLTEEKQTLLNMTLTHEIGDHKLQFKPLLARLYASRKYAPLWTDNAAARQLLRDYAA MVASGISKSSATSLETLALVEQQGGLVYDVLLSDILLDYLYYTQNVRSQASNWLYSSAQY QAQQPENDHIQRWLSAVENNQLLDFIQSLAGENHLYRQTIQSLPMFIPTSKESNITQKLA MNAQRLRVIPDFHNGIFVNIPSYKLQYYRDGDLILESRVIVGTNSRRTPVMYSKLSNVVV NPPWNAPIRLINEDLLPKMKADPNYITEHNYSILDNQGNVVDPASIDWESIDNKFPYRVR QAAGDSALGNYKFNMPSSDAIYLHDTPNRGLFNRKNRALSSGCVRVEKSDQLASILLKEA GWTETRKNTVLASKKTTSAPIRSDNPVFLYYVTAWIENGNIVNLPDIYGYDRQINLAEIN WDLVKKYLQ
Uniprot No.

Target Background

Database Links

KEGG: hin:HI1667

STRING: 71421.HI1667

Protein Families
YkuD family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the basic structure and characteristics of HI_1667?

HI_1667 is a putative L,D-transpeptidase from Haemophilus influenzae with a full length of 489 amino acids. The amino acid sequence begins with MVVFKSTLKL and ends with DLVKKYLQ, featuring a His-tag when expressed recombinantly . The protein is derived from the completely sequenced genome of Haemophilus influenzae Rd . When analyzing its physicochemical properties, standard parameters include molecular weight, isoelectric point, extinction coefficient, instability index, aliphatic index, and grand average of hydropathicity (GRAVY) . These parameters are essential for understanding basic protein behavior in experimental conditions and can be calculated using tools like Expasy's ProtParam server .

How should HI_1667 be stored and reconstituted for experimental use?

For optimal storage of recombinant HI_1667, the protein should be stored at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use scenarios . Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided to maintain protein integrity . For reconstitution, briefly centrifuge the vial before opening to bring contents to the bottom, then reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL . Adding glycerol to a final concentration of 5-50% is recommended before aliquoting for long-term storage, with 50% being the standard concentration . The reconstituted protein is typically stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

What is the genomic context of HI_1667 in Haemophilus influenzae?

HI_1667 is encoded within the Haemophilus influenzae genome, which has been completely sequenced as part of comprehensive genomic studies . The Haemophilus influenzae Rd genome sequencing project identified over 1700 protein-encoding fragments, including HI_1667 . To understand the genomic context, researchers should examine regulatory elements that modulate the expression of HI_1667, which can be identified by their position relative to unique restriction endonuclease sites in the genome . This genomic context is critical for understanding the protein's native expression patterns and potential functional associations with neighboring genes.

What computational approaches can be used to predict the function of HI_1667?

Predicting the function of HI_1667 requires a multi-layered computational approach. Begin with sequence similarity searches using BLASTp against non-redundant protein databases, considering proteins with >40% sequence identity and e-values <0.005 as close homologs . For remote homology detection, employ HHpred, which utilizes pairwise comparison of profile hidden Markov models to search databases like PDB, SCOP, and CATH . Domain prediction tools such as Pfam, SUPERFAMILY, PANTHER, SYSTERS, SVMProt, CDART, SMART, and ProtoNet can provide insights into functional domains . For motif discovery, use InterProScan, which integrates multiple protein signature recognition methods . MOTIF and MEME suite are valuable for motif-sequence database searching and function assignment . When analyzing MOTIF output, verify whether the SCOP database predicted fold in HI_1667 is present in the MOTIF-generated functional annotations .

How can the putative L,D-transpeptidase activity of HI_1667 be experimentally validated?

Validating the L,D-transpeptidase activity of HI_1667 requires a systematic approach combining biochemical and structural analyses. Begin with recombinant protein expression in E. coli and purify using affinity chromatography via the His-tag . Design enzymatic assays using synthetic peptidoglycan fragments as substrates to measure transpeptidase activity, monitoring product formation through HPLC or mass spectrometry. Perform site-directed mutagenesis of predicted catalytic residues to confirm their role in enzyme function. Compare kinetic parameters with known L,D-transpeptidases to establish functional similarity. For structural validation, conduct X-ray crystallography or NMR studies of HI_1667 alone and in complex with substrates or inhibitors to identify the active site architecture. Additionally, perform in vivo complementation studies in L,D-transpeptidase-deficient bacterial strains to confirm functional relevance. These approaches collectively provide robust evidence for the predicted enzymatic activity.

What is the role of HI_1667 in Haemophilus influenzae pathogenesis and antibiotic resistance?

Investigating HI_1667's role in pathogenesis and antibiotic resistance requires a multifaceted experimental approach. L,D-transpeptidases contribute to peptidoglycan remodeling and are implicated in β-lactam resistance in several bacterial species. Generate HI_1667 knockout mutants in Haemophilus influenzae and assess changes in cell morphology, growth kinetics, and peptidoglycan composition. Perform minimum inhibitory concentration (MIC) assays with various β-lactam antibiotics comparing wild-type and mutant strains. Examine peptidoglycan cross-linking patterns using mass spectrometry before and after antibiotic exposure. Conduct in vivo infection studies to compare virulence between wild-type and knockout strains in appropriate animal models. Use transcriptomics to identify conditions that upregulate HI_1667 expression, particularly during antibiotic stress or host colonization. The combined data from these approaches will elucidate HI_1667's contribution to Haemophilus influenzae survival strategies and pathogenicity.

How can I optimize expression and purification of recombinant HI_1667?

Optimizing expression and purification of recombinant HI_1667 requires systematic parameter adjustment. For expression, test multiple E. coli strains (BL21(DE3), Rosetta, Arctic Express) to address potential codon bias issues . Evaluate various induction conditions by testing IPTG concentrations (0.1-1.0 mM), induction temperatures (16-37°C), and durations (4-24 hours). For challenging expressions, consider fusion partners beyond the His-tag, such as MBP or SUMO, to enhance solubility. During purification, optimize buffer conditions by testing different pH ranges (7.0-8.5) and salt concentrations (100-500 mM NaCl) to improve protein stability. Implement a multi-step purification strategy beginning with immobilized metal affinity chromatography (IMAC) using the His-tag, followed by size exclusion chromatography to achieve >90% purity . Monitor protein quality using SDS-PAGE at each step . For long-term storage, compare stability in different buffer formulations containing various stabilizing agents like glycerol (10-50%) and trehalose (2-10%) . Perform activity assays after each optimization step to ensure functional integrity is maintained.

What techniques are most effective for structural characterization of HI_1667?

For comprehensive structural characterization of HI_1667, employ a multi-technique approach. Begin with circular dichroism (CD) spectroscopy to assess secondary structure composition and thermal stability. For tertiary structure determination, X-ray crystallography provides high-resolution structural details—optimize crystallization conditions by screening precipitants, pH, temperature, and protein concentration with commercial sparse matrix screens. If crystallization proves challenging, nuclear magnetic resonance (NMR) spectroscopy can be employed for proteins under 50 kDa, though HI_1667's 489 amino acids may necessitate selective isotopic labeling strategies. Cryo-electron microscopy (cryo-EM) offers an alternative approach, particularly valuable if HI_1667 forms higher-order assemblies. For dynamic structural information, hydrogen-deuterium exchange mass spectrometry (HDX-MS) can identify flexible regions and conformational changes upon substrate binding. Complementing experimental approaches, computational modeling using tools like SWISS-MODEL or I-TASSER can generate preliminary structural models based on homologous proteins identified through HHpred searches . Integrate these methodologies for a comprehensive understanding of HI_1667's structure-function relationship.

How can I design substrate specificity assays for HI_1667?

Designing substrate specificity assays for HI_1667 requires a systematic approach to characterize its putative L,D-transpeptidase activity. Begin by synthesizing or purchasing a panel of peptidoglycan fragment analogs with varying compositions to determine substrate preferences. Establish a reliable detection method such as HPLC with UV detection, mass spectrometry, or fluorescence-based assays using labeled substrates. For initial screening, develop a medium-throughput assay using synthetic peptide substrates containing D-amino acids with chromogenic or fluorogenic leaving groups. Determine optimal reaction conditions by varying pH (range 5.0-9.0), temperature (25-42°C), and buffer composition. Evaluate metal ion dependencies by testing various divalent cations (Mg²⁺, Mn²⁺, Ca²⁺, Zn²⁺) at different concentrations. For kinetic characterization, measure initial velocities at varying substrate concentrations to determine Km, Vmax, and kcat values. Compare HI_1667's specificity profile with known L,D-transpeptidases to establish functional relationships. Validate in vitro findings with whole-cell assays examining peptidoglycan composition changes when HI_1667 is overexpressed or deleted in Haemophilus influenzae.

How should I interpret sequence similarity results for HI_1667?

When interpreting sequence similarity results for HI_1667, implement a structured analytical framework. First, distinguish between close homologs (>40% sequence identity, e-value <0.005) and remote homologs (<26% identity) . For close homologs, functional annotation transfer is generally reliable, while remote homology requires additional supporting evidence. Examine the distribution of sequence conservation across the protein—clustered conservation often indicates functional sites. When using BLASTp, prioritize hits with high query coverage (>50%) and significant sequence identity (>20%) . For HHpred analyses, which leverage profile hidden Markov models, consider matches to proteins with solved structures in PDB as particularly informative . Cross-reference functional domains identified across multiple tools (Pfam, SUPERFAMILY, CATH, etc.) to build consensus predictions . Evaluate evolutionary relationships using phylogenetic analyses to identify orthologous relationships, which support function conservation. When conflicting functional predictions emerge, prioritize experimental evidence from characterized homologs. Additionally, examine genomic context conservation, as genes with conserved neighboring genes often share functional relationships.

What are the common challenges in analyzing HI_1667 experimental data and how can they be addressed?

Analyzing experimental data for HI_1667 presents several challenges requiring specific mitigation strategies. Protein purity assessment may be complicated by co-purifying bacterial proteins; address this by implementing stringent multi-step purification protocols and confirming identity through mass spectrometry . Activity assays may yield inconsistent results due to improper protein folding; validate structural integrity through circular dichroism before functional studies. When measuring enzymatic activity, substrate availability can be limiting; develop synthetic substrate analogs that maintain essential recognition elements. Data interpretation may be confounded by background enzymatic activities from the expression host; include appropriate negative controls using empty vector-transformed E. coli lysates . For in vivo studies, phenotypic changes in knockout strains may be subtle due to functional redundancy; perform comprehensive analyses including growth curves under various stress conditions and detailed peptidoglycan composition studies. Inter-laboratory reproducibility issues can arise from different recombinant protein preparations; standardize expression and purification protocols with detailed reporting of buffer compositions and storage conditions . When publishing results, clearly document experimental conditions, quality control measures, and raw data to facilitate validation and meta-analysis by the broader scientific community.

How can contradictory functional predictions for HI_1667 be reconciled?

Reconciling contradictory functional predictions for HI_1667 requires a systematic evaluation framework. Begin by assessing the reliability of each prediction method—predictions from experimentally validated homologs generally carry more weight than purely computational inferences . Examine the confidence scores associated with each prediction; for instance, SVMProt classifications with R-values >2.0 and P-values >60% are considered significant . Consider evolutionary context by analyzing the conservation pattern of HI_1667 across different bacterial species, particularly focusing on residues predicted to be functionally important. Integrate structural predictions to determine if the protein possesses the catalytic residues and fold characteristic of L,D-transpeptidases. When conflicting domain annotations arise, prioritize those detected by multiple independent methods such as Pfam, SUPERFAMILY, and SMART . Develop targeted experimental approaches to directly test competing functional hypotheses, such as site-directed mutagenesis of predicted catalytic residues followed by activity assays. Consider the possibility that HI_1667 may be multifunctional or possess substrate promiscuity, which could explain seemingly contradictory predictions. Finally, examine the protein in its biological context by analyzing its expression patterns, protein-protein interactions, and phenotypic effects of gene deletion to provide additional evidence supporting specific functional assignments.

How can I design experiments to study HI_1667 interactions with other cellular components?

Designing experiments to study HI_1667 interactions requires a multi-layered approach combining in vitro and in vivo methodologies. Begin with affinity purification coupled with mass spectrometry (AP-MS) using His-tagged HI_1667 as bait to identify interaction partners in Haemophilus influenzae lysates . Validate primary interactions through reciprocal co-immunoprecipitation and Western blotting. For in vivo interaction studies, implement bacterial two-hybrid systems or fluorescence resonance energy transfer (FRET) with fluorescently-tagged proteins. Crosslinking mass spectrometry can map interaction interfaces at amino acid resolution—use MS-cleavable crosslinkers for improved identification of crosslinked peptides. Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) provide quantitative binding parameters (Kd, kon, koff) for purified interaction partners. To study membrane-associated interactions, reconstitute the system in proteoliposomes with defined lipid compositions. Examine genetic interactions through synthetic lethality screens, comparing growth phenotypes of single and double mutants. For substrate interactions, develop activity-based protein profiling using mechanism-based probes that covalently modify the active site. Integrate computational approaches like molecular docking and molecular dynamics simulations to generate testable hypotheses about interaction mechanisms and to interpret experimental data in a structural context.

What animal models are appropriate for studying HI_1667 function in vivo?

Selecting appropriate animal models for studying HI_1667 function requires consideration of both pathogen biology and specific research questions. Since Haemophilus influenzae is a human-specific pathogen, develop humanized mouse models expressing human-specific receptors or immune components to improve host-pathogen interaction fidelity. The infant rat model has been established for Haemophilus influenzae meningitis studies and can be adapted to evaluate HI_1667 knockout strains for virulence attenuation. For respiratory infection studies, implement mouse pulmonary challenge models with intranasal inoculation, comparing wild-type and HI_1667-deficient strains through bacterial load quantification, histopathology, and inflammatory marker measurement. Chinchilla models provide excellent systems for studying otitis media pathogenesis, a common Haemophilus influenzae infection. For antibiotic efficacy studies, if HI_1667 is implicated in resistance, use neutropenic mouse models treated with various β-lactam antibiotics. Develop transgenic mouse models expressing human serum components to study serum resistance mechanisms if HI_1667 contributes to immune evasion. When designing these experiments, implement power analyses to determine appropriate sample sizes, include rigorous controls including complemented mutant strains, and monitor animals for clinical signs using standardized scoring systems. Collect comprehensive endpoint data including bacterial burden in multiple tissues, host immune responses, and detailed histopathological analysis.

How can I design experiments to determine if HI_1667 is a suitable target for antimicrobial development?

Designing experiments to evaluate HI_1667 as an antimicrobial target requires a comprehensive target validation approach. Begin with essentiality assessment through conditional knockdown systems in Haemophilus influenzae, measuring growth impacts under various conditions relevant to infection sites. Perform comparative genomics across Haemophilus species and related pathogens to determine conservation and uniqueness of HI_1667, ensuring broad-spectrum potential while minimizing off-target effects on human proteins or microbiome members. Structurally characterize the protein through X-ray crystallography or cryo-EM, identifying druggable pockets distinct from human proteins . Develop a medium-throughput biochemical assay measuring L,D-transpeptidase activity for screening chemical libraries—optimize for Z' factor >0.7 to ensure assay robustness. For initial hit identification, screen fragment libraries and repurposing libraries containing approved drugs, prioritizing compounds with IC₅₀ <10 μM. Evaluate promising inhibitors for selectivity against human peptidyltransferases, cellular permeability in Gram-negative bacteria, and resistance development frequency. For in vivo validation, test lead compounds in animal infection models, monitoring bacterial burden reduction, compound pharmacokinetics, and toxicity profiles. Additionally, evaluate inhibitors in combination with existing antibiotics to identify synergistic interactions that could prevent resistance development or reduce effective dosages.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.