Recombinant Haemophilus influenzae Putative phosphoethanolamine transferase HI_1064 (HI_1064)

Shipped with Ice Packs
In Stock

Description

Recombinant Haemophilus influenzae Putative Phosphoethanolamine Transferase HI_1064 (HI_1064): Overview

Recombinant Haemophilus influenzae Putative Phosphoethanolamine Transferase HI_1064 (HI_1064) is a bioengineered protein derived from the HI_1064 gene of Haemophilus influenzae, a Gram-negative bacterium responsible for infections such as otitis media, meningitis, and pneumonia. This recombinant protein is primarily used in research to study bacterial pathogenesis, vaccine development, and lipid A modification mechanisms.

Functional Inference

HI_1064 is annotated as a putative phosphoethanolamine (PEA) transferase, a class of enzymes that catalyze the transfer of PEA groups to lipid A, a component of bacterial lipopolysaccharides (LPS). This modification is critical for bacterial survival under cationic antimicrobial peptide (CAMP) stress and may contribute to antimicrobial resistance .

2.1.1 Catalytic Mechanism

PEA transferases typically utilize a conserved catalytic threonine (Thr280 in Neisseria meningitidis EptA) and zinc-binding residues (e.g., Glu246, Asp465, His466, His478) to form a covalent enzyme-PEA intermediate . While HI_1064’s activity is inferred, its sequence alignment with homologs suggests similar catalytic motifs .

Vaccine Development

HI_1064 is explored as a vaccine candidate due to its role in bacterial surface modifications. Recombinant HI_1064 is used to study immune responses and epitope mapping .

LPS Modification Studies

As a PEA transferase, HI_1064 may modify lipid A’s phosphate groups, altering bacterial resistance to CAMPs like colistin . This aligns with findings in Pseudomonas aeruginosa (EptAPa) and Enterobacteriaceae (MCR-1) .

Comparative Analysis with Other PEA Transferases

EnzymeSourceSubstrate SpecificityRole in Resistance
HI_1064H. influenzaePutative lipid A modificationPotential CAMP resistance
MCR-1EnterobacteriaceaeLipid A phosphate groupsColistin resistance
EptAEscherichia coliLipid A and HepIIPolymyxin resistance
EptBEnterobacteriaceaeInner core sugars (e.g., Kdo)Doxycycline/minocycline resistance

Data synthesized from .

Genomic Integration

HI_1064 is encoded in the H. influenzae Rd genome (GenBank: U32821), part of a strain sequenced to 99.98% accuracy . The gene is flanked by open reading frames (ORFs) involved in metabolism and virulence .

Regulatory Pathways

While not directly studied for HI_1064, PEA transferases in other pathogens (e.g., EptB in Enterobacteriaceae) are regulated by PhoPQ systems, which sense magnesium starvation or CAMPs . Similar regulation may govern HI_1064 expression.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary based on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All of our proteins are shipped standard with normal blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its implementation.
Synonyms
HI_1064; Putative phosphoethanolamine transferase HI_1064
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-485
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
HI_1064
Target Protein Sequence
MKKLNMEILSERWIIATFSFQGRQYNTKKTSQILPALFAVICAAFAGYFILIGSGMFTEP SVALILLATITILLLSSSKKSFYFILLPLTLLHAFYTPTGLNFGPPSYQYIASLFATDIL ETKEFLLQIPVSSYLIAFAIPILIFLQYKSAVKFGIKFYRNKTFIALATLLFAYNMPLAE PLKETVSSTLKIVDEVQKLKQISQSDNWGKSTLENSRYDDYVIVLGESARKDYHHAYGYP IENTPFMSNAKGTLIDGFRSAGTNTVASLRLMLTFPDKEKWEPNYSLSLVDLIKSAGIKT YWLSNHGMIGKFDTPVSSLASKSDETFFLKKGGSFNSTNFSDFDLLPKFAQVLENSVQGK RFIVLHIYGSHPMACDRIEDYPKIFDDKDLNPRYGYLNCYVSSIKKTDEFLKRVYDQLEE NVKKNHRTFSMIYFSDHGLCHQQDEKTIYFCSIKTVSAESTIIFRYSKFHQMIWNAKNIR CLNQV
Uniprot No.

Target Background

Database Links

STRING: 71421.HI1064

Protein Families
Phosphoethanolamine transferase family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Haemophilus influenzae and what role does the HI_1064 protein play?

Haemophilus influenzae is a Gram-negative, coccobacillary, facultatively anaerobic pathogenic bacterium belonging to the Pasteurellaceae family. Also known as Pfeiffer's bacillus or Bacillus influenzae, this organism was the first free-living organism to have its entire genome sequenced . H. influenzae is responsible for various localized and invasive infections, with six encapsulated types (a-f) identified .

The HI_1064 protein is classified as a putative phosphoethanolamine transferase with EC number 2.7.-.- . Phosphoethanolamine transferases typically play crucial roles in bacterial membrane modifications, which can affect antimicrobial resistance, host-pathogen interactions, and virulence. The specific function of HI_1064 within H. influenzae involves transferring phosphoethanolamine groups to cell surface structures, potentially modifying the bacterium's interaction with host immune responses or antibiotics.

How is recombinant HI_1064 protein typically produced for research purposes?

Recombinant HI_1064 protein can be produced through several expression systems depending on the specific research requirements. Common expression systems include:

  • Bacterial expression (E. coli): Most commonly used due to ease of culture, rapid growth, and high protein yields .

  • Yeast expression systems: Provide eukaryotic post-translational modifications while maintaining relatively high yields .

  • Baculovirus expression: Offers more complex eukaryotic processing capabilities .

  • Mammalian cell expression: Provides the most natural post-translational modifications for studying protein function .

The typical production workflow involves:

Production StepMethodologyConsiderations
Gene cloningPCR amplification of HI_1064 gene (1-485 aa) with appropriate restriction sitesCodon optimization may be necessary for the host system
Vector constructionInsertion into expression vector with appropriate tagsHis-tag is common for purification purposes
Transformation/TransfectionIntroduction of vector into host cellsEfficiency varies by host system
Expression inductionIPTG for E. coli; other inducers for other systemsTemperature, inducer concentration, and timing affect yield
Cell lysisSonication, French press, or chemical lysisBuffer selection critical for maintaining protein stability
PurificationAffinity chromatography (His-tag), followed by size exclusionMultiple steps may be needed for highest purity
StorageTypically in Tris-based buffer with 50% glycerol at -20°C or -80°CAvoid repeated freeze-thaw cycles

The yield and functional characteristics of the protein may vary significantly depending on the expression system chosen, with trade-offs between quantity and quality of the final product.

What considerations are important when designing experiments involving HI_1064?

When designing experiments with recombinant HI_1064, researchers should consider several factors to ensure valid and reproducible results:

  • Protein stability: HI_1064 stability should be assessed under experimental conditions. Tris-based buffers with 50% glycerol are commonly used for storage, but buffer composition may need optimization for specific assays .

  • Enzymatic activity assessment: As a putative phosphoethanolamine transferase, activity assays should include:

    • Appropriate substrate availability

    • Consideration of divalent cation requirements (typically Mg²⁺ or Mn²⁺)

    • pH optimization (typically between 6.5-8.0)

    • Temperature controls

  • Controls and validation:

    • Negative controls (heat-inactivated enzyme)

    • Positive controls (known phosphoethanolamine transferases)

    • Substrate-only controls

    • Validation using mass spectrometry to confirm transfer of phosphoethanolamine groups

A well-designed experiment will incorporate the principles outlined in standardized experimental design protocols, including proper hypothesis formulation, variable control, and systematic data collection methods .

How should researchers approach characterizing HI_1064 enzymatic activity?

Characterizing the enzymatic activity of HI_1064 requires a methodical approach:

  • Substrate identification:

    • Test various potential lipid A or other cell surface components as substrates

    • Use radiolabeled (³²P) or fluorescently labeled phosphoethanolamine to track transfer

  • Reaction conditions optimization:

ParameterRange to TestMonitoring Method
pH5.5-9.0 in 0.5 incrementsActivity assay at each pH point
Temperature25°C-45°C in 5°C incrementsActivity assay at each temperature
Divalent cationsMg²⁺, Mn²⁺, Ca²⁺, Zn²⁺ (0-10 mM)Activity with/without each cation
CofactorsATP, GTP, NAD+, NADP+Activity with/without each cofactor
  • Kinetic analysis:

    • Determine Km and Vmax using varying substrate concentrations

    • Plot Lineweaver-Burk or Eadie-Hofstee graphs for analysis

    • Calculate catalytic efficiency (kcat/Km)

  • Inhibition studies:

    • Test known phosphoethanolamine transferase inhibitors

    • Determine IC₅₀ values and inhibition mechanisms

  • Product confirmation:

    • Mass spectrometry to confirm phosphoethanolamine addition

    • NMR analysis for structural verification of modifications

This systematic approach allows for comprehensive characterization of the enzymatic properties of HI_1064, establishing its specific role in phosphoethanolamine transfer reactions.

What are the best approaches for studying protein-protein interactions involving HI_1064?

Several complementary techniques can be employed to study protein-protein interactions involving HI_1064:

  • Co-immunoprecipitation (Co-IP):

    • Use anti-HI_1064 antibodies to pull down protein complexes

    • Identify interacting partners via mass spectrometry

    • Validate interactions with reverse Co-IP

  • Yeast two-hybrid screening:

    • Create HI_1064 bait constructs

    • Screen against H. influenzae genomic library

    • Confirm interactions with secondary assays

  • Biolayer interferometry or surface plasmon resonance:

    • Immobilize purified HI_1064 on sensor chips

    • Measure binding kinetics with potential partners

    • Determine kon, koff, and KD values

  • Proximity-based labeling:

    • Create HI_1064-BioID or APEX2 fusion proteins

    • Express in native context to label proximal proteins

    • Identify labeled proteins by streptavidin pulldown and mass spectrometry

  • Molecular dynamics simulations:

    • Similar to approaches used in peptide-protein interaction studies

    • Monitor parameters such as:

      • Root mean square deviation (RMSD)

      • Solvent accessible surface area (SASA)

      • Radius of gyration (Rg)

      • Root mean square fluctuation (RMSF)

      • Binding residue persistence

Each method has strengths and limitations, so a combination of approaches provides the most comprehensive understanding of HI_1064's interaction network.

How can molecular dynamics simulations be applied to study HI_1064 structure and function?

Molecular dynamics (MD) simulations offer powerful insights into HI_1064's structural dynamics and functional mechanisms. Based on approaches used in similar protein studies , the following methodology is recommended:

The temporal persistence of interactions between protein residues and substrate/inhibitor molecules is particularly informative, as seen in similar simulation studies where residues with >90% temporal presence in interactions typically represent critical functional sites .

What approaches can be used to investigate the role of HI_1064 in antimicrobial resistance?

Investigating HI_1064's potential role in antimicrobial resistance requires a multi-faceted approach:

  • Gene knockout and complementation studies:

    • Create ΔHI_1064 mutant strains

    • Perform antimicrobial susceptibility testing

    • Complement with wild-type and site-directed mutants

    • Measure MIC values for various antibiotics

  • Lipopolysaccharide (LPS) modification analysis:

    • Extract LPS from wild-type and mutant strains

    • Analyze by mass spectrometry for phosphoethanolamine modifications

    • Correlate modifications with resistance profiles

  • Membrane integrity studies:

    • Fluorescent dye permeability assays

    • Atomic force microscopy of bacterial surfaces

    • Electron microscopy to visualize membrane architecture

  • Transcriptomic and proteomic analyses:

    • RNA-Seq comparing wild-type and ΔHI_1064 strains

    • Identify compensatory mechanisms

    • Protein expression changes in response to antibiotic challenge

  • In vivo infection models:

    • Assess virulence of ΔHI_1064 mutants

    • Evaluate antibiotic efficacy in animal models

    • Monitor emergence of resistance during treatment

This comprehensive approach can establish whether HI_1064-mediated phosphoethanolamine transfer contributes to antimicrobial resistance through mechanisms such as altered membrane permeability, modified drug binding sites, or activation of efflux pumps.

What computational approaches can be used to identify potential inhibitors of HI_1064?

Identifying potential inhibitors of HI_1064 can be approached using computational methods similar to those applied in other drug discovery efforts :

  • Virtual screening workflow:

    • Database preparation (commercial or custom libraries)

    • Structure-based or ligand-based filtering

    • Molecular docking against HI_1064 active site

    • Scoring and ranking of compounds

    • Selection of top candidates for experimental validation

  • Molecular docking strategy:

    • Identify catalytic residues (likely including conserved histidine and cysteine residues)

    • Define binding pocket dimensions

    • Consider flexible residues in docking simulations

    • Use consensus scoring from multiple algorithms

  • Molecular dynamics validation:

    • Subject top docking hits to MD simulations (25-100 ns)

    • Analyze RMSD, RMSF, and binding persistence

    • Calculate binding free energies

    • Identify compounds with stable interactions with catalytic residues

  • Selection criteria for experimental testing:

ParameterThresholdRationale
Docking scoreTop 1% of screened compoundsInitial filtering
Binding free energy< -7 kcal/molStrong binding prediction
Catalytic residue interaction>90% persistence during MDCritical for inhibition
RMSD of bound compound<2.5 Å throughout simulationStable binding mode
Drug-likeness (Lipinski)≥3 criteria metFavorable pharmacokinetics
  • Refinement and optimization:

    • Structure-activity relationship analysis

    • Fragment-based design for lead optimization

    • ADMET prediction for promising candidates

This computational pipeline, validated through the success of similar approaches in identifying peptide inhibitors against viral proteases , provides a resource-efficient strategy for discovering potential HI_1064 inhibitors that can then be experimentally validated.

What are the key considerations for ensuring reproducibility in HI_1064 research?

Ensuring reproducibility in HI_1064 research requires attention to several critical factors:

  • Protein production consistency:

    • Document expression system details (strain, vector, tags)

    • Standardize induction conditions (time, temperature, inducer concentration)

    • Validate protein quality by SDS-PAGE, mass spectrometry, and activity assays

    • Record and report batch-to-batch variation

  • Experimental protocol standardization:

    • Develop detailed standard operating procedures (SOPs)

    • Include all buffer compositions with exact pH values

    • Specify equipment models and settings

    • Document environmental conditions (temperature, humidity)

  • Data collection and analysis:

    • Use appropriate statistical methods with justified sample sizes

    • Include all raw data in supplementary materials

    • Document data processing steps and parameters

    • Use open-source analysis software when possible

  • Experimental design considerations:

    • Follow structured experimental design principles

    • Include appropriate positive and negative controls

    • Blind experimenters to treatment groups when possible

    • Randomize sample processing order

  • Reporting standards:

    • Follow STROBE or similar reporting guidelines

    • Document all failed approaches and negative results

    • Share protocols on platforms like protocols.io

    • Deposit data in appropriate repositories

Adherence to these practices will significantly improve the reproducibility of HI_1064 research and facilitate building upon previous findings in a systematic manner.

How can researchers troubleshoot common issues in experiments involving HI_1064?

Researchers may encounter several challenges when working with HI_1064. Here are troubleshooting approaches for common issues:

  • Low protein expression:

IssueTroubleshooting Approach
Poor expressionOptimize codon usage for expression host
Try different promoters or induction conditions
Test alternative expression hosts
Protein degradationAdd protease inhibitors during purification
Reduce expression temperature
Create fusion constructs (MBP, SUMO)
  • Protein insolubility:

    • Modify lysis buffer composition (detergents, salts, pH)

    • Express as fusion with solubility-enhancing tags

    • Attempt refolding from inclusion bodies

    • Test membrane-mimicking environments (nanodiscs, liposomes)

  • Lack of enzymatic activity:

    • Ensure proper cofactor availability

    • Verify substrate quality and concentration

    • Test different buffer conditions

    • Consider protein-protein interaction requirements

    • Verify protein is properly folded via circular dichroism

  • Inconsistent assay results:

    • Standardize reagent preparation

    • Control for enzyme batch variation

    • Optimize assay conditions (time, temperature, pH)

    • Use internal standards

    • Increase technical and biological replicates

  • Computational analysis challenges:

    • For MD simulations with unstable trajectories, adjust equilibration protocols

    • For docking inconsistencies, try multiple software packages

    • When encountering high RMSD values, extend simulation time or refine force field parameters

Systematic troubleshooting using these approaches can help overcome technical challenges and improve experimental outcomes when working with HI_1064.

What are the emerging research trends involving HI_1064 and similar phosphoethanolamine transferases?

Current research on phosphoethanolamine transferases like HI_1064 is revealing their importance in several key areas:

  • Antimicrobial resistance mechanisms:

    • Modification of lipopolysaccharide structure affecting polymyxin resistance

    • Altered membrane permeability to various antibiotics

    • Cross-resistance patterns to multiple drug classes

  • Structural biology advances:

    • Cryo-EM structures of membrane-embedded transferases

    • Catalytic mechanism elucidation through transition state analogs

    • Conformational dynamics during substrate binding and product release

  • Systems biology integration:

    • Network analysis of resistance determinants

    • Transcriptional regulation under antibiotic stress

    • Metabolic consequences of membrane modification

  • Evolutionary considerations:

    • Horizontal gene transfer of phosphoethanolamine transferases

    • Selective pressures in clinical versus environmental settings

    • Convergent evolution of resistance mechanisms

  • Therapeutic target potential:

    • Inhibitor development targeting conserved catalytic sites

    • Combination therapies to overcome resistance

    • Adjuvant approaches to restore antibiotic sensitivity

These research trends suggest that HI_1064 may have significant importance beyond its enzymatic function, potentially playing roles in pathogen-host interactions, environmental adaptation, and clinical outcomes of H. influenzae infections.

How might CRISPR-Cas9 technology be applied to study HI_1064 function in Haemophilus influenzae?

CRISPR-Cas9 technology offers powerful approaches for investigating HI_1064 function:

  • Gene knockout and complementation:

    • Design sgRNAs targeting HI_1064 gene

    • Create clean deletions without polar effects

    • Complement with wild-type or mutant alleles

    • Generate conditional knockouts for essential genes

  • Base editing applications:

    • Introduce specific amino acid changes without double-strand breaks

    • Target catalytic residues for structure-function studies

    • Create resistance-associated mutations

    • Modify regulatory elements affecting expression

  • CRISPR interference (CRISPRi):

    • Repress HI_1064 expression without genomic modification

    • Create expression gradients with variable guide designs

    • Study dosage effects on phenotypes

    • Implement inducible repression systems

  • High-throughput functional genomics:

    • Create sgRNA libraries targeting HI_1064 interactors

    • Perform screens under various selective pressures

    • Identify synthetic lethal interactions

    • Map genetic interaction networks

  • In vivo applications:

    • Generate modified strains for animal infection models

    • Study tissue-specific requirements during infection

    • Track population dynamics during antibiotic treatment

    • Assess fitness costs of HI_1064 modifications

These CRISPR-based approaches provide unprecedented precision for studying HI_1064 function in its native context, potentially revealing new biological roles and therapeutic opportunities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.