Recombinant Haemophilus influenzae Putative TRAP transporter small permease protein HI_0051 (HI_0051)

Shipped with Ice Packs
In Stock

Description

Functional Insights

HI_0051 operates via an "elevator-with-an-operator" mechanism, driven by sodium gradients :

  • Substrate specificity: Transports N-acetylneuraminate (sialic acid), a virulence factor for H. influenzae .

  • SiaP interaction: Binds the substrate-binding protein SiaP with micromolar affinity (KD ≈ 1–10 µM) .

  • Key residues: R484, D480, and K236 form a salt bridge network essential for SiaP binding and transporter activity . Mutations (e.g., R484E) reduce bacterial growth by 50–80% .

Biochemical Characteristics

Commercial preparations (e.g., Creative BioMart Cat# RFL36242HF) exhibit:

ParameterSpecification
Purity≥90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Reconstitution0.1–1.0 mg/mL in sterile water; 50% glycerol for long-term storage
Amino acid sequenceMGDKEGACFMKIAKYLDKALEYLSILALVIMISLVFFNSVLRYFFDSGIAFSEEFSRICF...YKESSDK

Research Applications

  • Mechanistic studies: Used to resolve TRAP transporter dynamics via cryo-EM and mutagenesis .

  • Pathogenicity research: Links sialic acid uptake to H. influenzae survival in host environments .

  • Protein interaction assays: Facilitates in vitro binding studies with SiaP and homologs .

Evolutionary and Genomic Context

  • Horizontal gene transfer: Codon usage analysis suggests HI_0051 may have originated from non-Haemophilus species .

  • Supra-genome role: Classified as a contingency gene, variably present across H. influenzae strains .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to concentrate the contents. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
HI_0051; Putative TRAP transporter small permease protein HI_0051
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
HI_0051
Target Protein Sequence
MGDKEGACFMKIAKYLDKALEYLSILALVIMISLVFFNSVLRYFFDSGIAFSEEFSRICF VYMISFGIILVAKDKAHLTVDIIIPALPEQYRKIVLIVANICVLIAMIFIAYGALQLMSL TYTQQMPATGISSSFLYLAAVISAVSYFFIVMFSMIKDYKESSDK
Uniprot No.

Target Background

Database Links

KEGG: hin:HI0051

STRING: 71421.HI0051

Protein Families
TRAP transporter small permease family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.