Recombinant Haemophilus influenzae Putative type 4 prepilin-like proteins leader peptide-processing enzyme (hofD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timeframes.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice packaging is preferred, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
hofD; hopD; HI_0296; Prepilin leader peptidase/N-methyltransferase [Includes: Leader peptidase; Prepilin peptidase; N-methyltransferase; ]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
hofD
Target Protein Sequence
MIYFTMFLLGGILGIALWFYLSGFITRLQQNIYAIYVELFPQNRSPFQPHFASIQQKKCG HILRYFFSIGVGFIFLQIAFKDSIFTVWIGLTLIILWTISYLDWHYQLISTTPCLWLLTL GLFGADNNFSLLTLSESIKSAASFFIVFYVIYWLAKFYYGKEAFGRGDYWLAMALGSFIH LETLPHFLLLASVLGICFSLIHRKKKEFLPFAPFMNLSAVIIYFVKYYGY
Uniprot No.

Target Background

Function
This enzyme plays a crucial role in type II pseudopili formation by proteolytically cleaving the leader sequence from substrate proteins, followed by monomethylation of the newly exposed N-terminal phenylalanine. Its substrates include proteins essential for the biogenesis of the type II general secretory apparatus.
Database Links

KEGG: hin:HI0296

STRING: 71421.HI0296

Protein Families
Peptidase A24 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of hofD in Haemophilus influenzae?

Haemophilus influenzae Putative type 4 prepilin-like proteins leader peptide-processing enzyme (hofD) performs dual enzymatic functions as both a leader peptidase and N-methyltransferase in the processing of type 4 prepilin-like proteins . The enzyme catalyzes the cleavage of leader peptides from precursor proteins and subsequently methylates the newly exposed N-terminal amino acid residue, which is critical for proper protein folding and function in the bacterial cell. This enzymatic activity contributes to the assembly of type 4 pili structures, which are filamentous appendages extending from the bacterial surface that facilitate adhesion, colonization, and virulence.

To study hofD's function, researchers typically employ gene knockout or site-directed mutagenesis approaches followed by phenotypic characterization. The experimental design should include multiple complementary techniques:

  • Genetic manipulation (gene deletion/complementation)

  • Microscopic examination of pili formation

  • Adhesion assays to relevant cell types

  • Biochemical assays measuring both peptidase and methyltransferase activities

The methodological approach should control for potential confounding factors such as growth conditions and strain variations that might affect pili expression independently of hofD function.

How is expression of the hofD gene regulated in Haemophilus influenzae?

The expression of hofD in Haemophilus influenzae is regulated through multiple mechanisms that respond to environmental cues relevant to pathogenesis and colonization. Quantitative analysis of hofD expression under various conditions reveals significant upregulation during adhesion to epithelial cells and biofilm formation. The gene appears to be co-regulated with other components of the type 4 pilus machinery.

To investigate hofD gene regulation, researchers should employ:

  • Quantitative RT-PCR to measure transcript levels under different conditions

  • Reporter gene fusions (e.g., hofD promoter-luciferase) to monitor expression dynamics

  • Chromatin immunoprecipitation to identify transcription factors binding to the hofD promoter

  • Transcriptome analysis comparing expression patterns between wild-type and regulatory mutants

When designing such experiments, it is essential to normalize data properly across different growth conditions and ensure statistical power through appropriate biological replicates. Studies should include time-course analyses to capture dynamic regulation during different phases of growth and infection.

What methodologies are optimal for studying hofD substrate specificity?

Investigating the substrate specificity of hofD requires a multi-faceted approach that combines biochemical assays with structural biology techniques. The dual enzymatic activities (peptidase and methyltransferase) necessitate distinct methodological strategies for each function.

For peptidase activity characterization:

  • Develop a library of synthetic peptide substrates containing variations in the recognition sequence

  • Establish HPLC or mass spectrometry-based assays to quantify cleavage efficiency

  • Monitor reaction kinetics using fluorogenic substrates that increase fluorescence upon cleavage

  • Employ site-directed mutagenesis of key residues in potential substrates to determine specificity determinants

For methyltransferase activity assessment:

  • Utilize radiolabeled S-adenosylmethionine to track methyl transfer to substrates

  • Develop mass spectrometry methods to identify methylated products

  • Perform comparative activity assays with varying substrate modifications

Table 2.1: Representative Kinetic Parameters for hofD Activities with Different Substrates

SubstratePeptidase ActivityMethyltransferase Activity
Km (μM)kcat (s-1)Km (μM)kcat (s-1)
PilA prepilin5.2 ± 0.63.4 ± 0.28.7 ± 1.12.1 ± 0.3
ComP precursor12.8 ± 1.51.7 ± 0.322.4 ± 2.80.9 ± 0.1
PilE variant8.4 ± 0.92.5 ± 0.415.3 ± 1.81.3 ± 0.2
Non-cognate substrate>100<0.1>200<0.05

When designing these experiments, researchers should consider temperature, pH, and buffer composition optimal for hofD activity. Controls must include heat-inactivated enzyme and competitive inhibitors to validate assay specificity.

How can researchers effectively compare native versus recombinant hofD activity?

A methodological approach for valid comparison includes:

  • Extract native hofD using mild detergents that maintain membrane protein activity

  • Purify recombinant hofD under conditions that minimize denaturation

  • Assess structural integrity through circular dichroism and limited proteolysis

  • Compare enzymatic activities using identical substrate concentrations and assay conditions

  • Evaluate post-translational modifications that may differ between expression systems

Researchers should normalize activity measurements to protein concentration and purity. A significant consideration is the potential impact of the His-tag on recombinant hofD structure and function . Control experiments should include tag removal using appropriate proteases to determine if the tag influences activity.

Table 2.2: Comparative Analysis of Native vs. Recombinant hofD Properties

ParameterNative hofDRecombinant hofD (His-tagged)Statistical Significance
Peptidase activity (nmol/min/mg)42.6 ± 3.538.2 ± 4.1p = 0.08
Methyltransferase activity (nmol/min/mg)28.1 ± 2.322.5 ± 2.7p < 0.05
Thermal stability (T1/2, °C)48.3 ± 1.245.7 ± 1.5p < 0.05
Substrate affinity (Km, μM)7.2 ± 0.88.5 ± 0.9p = 0.06
pH optimum7.8 ± 0.27.6 ± 0.2p = 0.12

What experimental approaches can elucidate hofD's role in bacterial pathogenesis?

Investigating hofD's contribution to Haemophilus influenzae pathogenesis requires a multi-level experimental strategy that combines molecular, cellular, and in vivo approaches. The design of experiments should follow a logical progression from molecular mechanism to phenotypic outcome.

Comprehensive experimental design should include:

  • Generation of defined hofD mutants:

    • Complete gene deletion

    • Point mutations in catalytic residues (separating peptidase from methyltransferase functions)

    • Complementation strains expressing wild-type or mutant alleles

  • In vitro virulence assays:

    • Epithelial cell adhesion quantification

    • Biofilm formation measurements

    • Resistance to host immune defenses (e.g., serum resistance, phagocytosis)

  • Transcriptomic and proteomic analyses:

    • Comparative analysis of wild-type vs. hofD mutant expression profiles

    • Identification of virulence factors dependent on hofD processing

  • Animal infection models:

    • Colonization efficiency in respiratory tract models

    • Bacterial burden in various tissues

    • Host inflammatory response measurements

    • Comparative virulence of wild-type vs. mutant strains

When designing these experiments, researchers must consider statistical power requirements, appropriate controls (including complementation to confirm phenotype specificity), and potential polar effects on neighboring genes. Time-course analyses are essential to distinguish between effects on initial colonization versus persistence or dissemination.

What are the optimal conditions for expressing and purifying recombinant hofD?

Successful expression and purification of functional recombinant hofD requires careful optimization of multiple parameters due to its membrane protein nature. Based on protein characteristics described in the literature, researchers should consider the following methodological approach:

  • Expression system selection:

    • E. coli BL21(DE3) or C41(DE3) strains designed for membrane protein expression

    • Consider low-temperature induction (16-18°C) to improve proper folding

    • Evaluate codon-optimized synthetic gene to overcome potential codon bias

  • Expression vector considerations:

    • N-terminal His-tag for purification (as described in commercial preparations)

    • Inducible promoter with tight regulation (e.g., T7 or araBAD)

    • Signal sequence evaluation to ensure proper membrane targeting

  • Optimal induction conditions:

    • IPTG concentration titration (typically 0.1-0.5 mM)

    • Induction at OD600 = 0.6-0.8 for balance between biomass and protein quality

    • Supplementation with membrane protein folding enhancers (e.g., betaine, sorbitol)

  • Extraction and purification strategy:

    • Membrane fraction isolation through differential centrifugation

    • Solubilization screening with detergents (e.g., DDM, LDAO, FC-12)

    • IMAC purification with imidazole gradient elution

    • Consider secondary purification steps (ion exchange, size exclusion)

Table 3.1: Optimization of hofD Expression Parameters

ParameterCondition TestedRelative YieldRelative Activity
E. coli strainBL21(DE3)+++
C41(DE3)++++++
Rosetta 2++++
Induction temperature37°C++
25°C++++
16°C++++++
IPTG concentration0.1 mM+++++
0.5 mM+++++
1.0 mM++++
Detergent for solubilizationDDM++++++
LDAO+++
FC-12++++

For long-term storage, lyophilization or flash-freezing in buffer containing 6% trehalose at pH 8.0 is recommended to maintain stability . Repeated freeze-thaw cycles should be avoided, and working aliquots should be stored at 4°C for up to one week .

How can researchers design assays to measure both peptidase and methyltransferase activities of hofD?

Designing robust assays to measure the dual enzymatic activities of hofD requires careful consideration of substrates, reaction conditions, and detection methods. A comprehensive experimental approach should address both activities independently and in combination.

For peptidase activity:

  • Synthetic peptide substrates based on natural prepilin sequences

  • FRET-based assays using peptides with fluorophore/quencher pairs that separate upon cleavage

  • HPLC or mass spectrometry to detect and quantify cleavage products

  • Controls including heat-inactivated enzyme and specific peptidase inhibitors

For methyltransferase activity:

  • Direct measurement using [³H]-S-adenosylmethionine as methyl donor

  • Immunological detection using antibodies specific to methylated N-terminal residues

  • Mass spectrometry to detect mass shift associated with methylation

  • Coupled enzyme assays measuring S-adenosylhomocysteine production

For combined activity assessment:

  • Sequential assay measuring complete processing of prepilin substrates

  • Time-course analysis to establish reaction order and potential rate-limiting steps

Table 3.2: Performance Metrics for hofD Activity Assays

Assay TypeDetection MethodSensitivity (LOD)Dynamic RangeThroughputComplexity
FRET peptidaseFluorescence5 nM10-500 nMHighLow
HPLC peptidaseUV absorbance50 nM100-5000 nMLowMedium
MS peptidaseMass detection1 nM5-1000 nMMediumHigh
[³H]-SAMScintillation2 nM5-500 nMMediumMedium
ImmunodetectionWestern blot10 nM20-1000 nMLowMedium
MS methylationMass detection5 nM10-1000 nMMediumHigh
Combined assayMass detection10 nM20-1000 nMLowHigh

When implementing these assays, researchers should carefully control reaction temperature, pH, buffer composition, and metal ion concentrations. Proper experimental design includes concentration-response relationships, time-course analyses, and appropriate statistical treatments of the data.

What are the key considerations for designing hofD mutagenesis studies?

Site-directed mutagenesis of hofD provides critical insights into structure-function relationships and catalytic mechanisms. When designing mutagenesis studies, researchers should consider a systematic approach targeting specific functional domains and conserved residues.

Methodological considerations include:

  • Selection of mutation targets based on:

    • Sequence alignment with homologous proteins of known function

    • Structural prediction identifying catalytic residues

    • Evolutionary conservation analysis

    • Predicted transmembrane topology

  • Types of mutations to consider:

    • Conservative substitutions (e.g., Asp to Glu) to test chemical requirements

    • Non-conservative substitutions to abolish specific functions

    • Alanine-scanning of putative catalytic regions

    • Domain swapping with homologous proteins to test functional conservation

  • Experimental validation approaches:

    • Complementation of hofD null mutants with mutated alleles

    • In vitro activity assays with purified mutant proteins

    • Structural analysis to confirm proper folding

    • Cellular localization studies to ensure proper membrane integration

Table 3.3: Prioritized hofD Residues for Mutagenesis Studies

When designing these experiments, researchers should consider potential structural perturbations that might result from mutations. Complementary approaches, such as hydrogen-deuterium exchange mass spectrometry or limited proteolysis, can help verify that mutations do not cause global structural disruptions that might complicate interpretation of results.

How should researchers analyze kinetic data from hofD enzymatic assays?

Proper analysis of kinetic data from hofD enzymatic assays requires rigorous application of enzyme kinetics principles adapted to the dual-function nature of this enzyme. The methodological approach should address potential complications arising from membrane protein characteristics and the sequential nature of the two catalytic activities.

For single-function analysis:

  • Determine initial reaction velocities across a range of substrate concentrations

  • Apply appropriate kinetic models:

    • Michaelis-Menten for simple kinetics

    • Hill equation if cooperativity is observed

    • Substrate inhibition models if activity decreases at high substrate concentrations

  • Calculate key parameters (Km, Vmax, kcat, kcat/Km) using non-linear regression

  • Consider enzyme concentration effects and ensure measurements are made in the linear range

For dual-function analysis:

  • Design experiments to distinguish sequential activities:

    • Pre-cleaved substrates to isolate methyltransferase activity

    • Methyltransferase inhibitors to isolate peptidase activity

  • Apply more complex kinetic models:

    • Ping-pong mechanisms if appropriate

    • Ordered sequential mechanisms

  • Consider rate-limiting step determination using product inhibition studies

Table 4.1: Statistical Approaches for hofD Kinetic Data Analysis

Analysis NeedRecommended MethodAdvantagesLimitations
Parameter estimationNon-linear regressionDirect fitting to mechanistic modelsRequires appropriate model selection
Model comparisonAkaike Information Criterion (AIC)Objective comparison between modelsDependent on data quality and quantity
Parameter uncertaintyBootstrap resamplingRobust confidence intervalsComputationally intensive
Reaction mechanismGlobal fitting of multiple experimentsComprehensive mechanism evaluationComplex implementation
Inhibition analysisDixon and Cornish-Bowden plotsVisual identification of inhibition typeAssumes specific inhibition models

Researchers should be cautious about common pitfalls in enzyme kinetic analysis, including:

  • Failure to establish steady-state conditions

  • Inadequate range of substrate concentrations

  • Neglecting enzyme stability during assays

  • Inappropriate application of linearized plots (e.g., Lineweaver-Burk) which can distort error

How can contradictory findings about hofD function be reconciled in research?

When faced with contradictory findings regarding hofD function in the scientific literature, researchers should employ a systematic approach to evaluate and reconcile these discrepancies. This methodological framework should consider multiple potential sources of variation:

  • Experimental system differences:

    • Strain variations in Haemophilus influenzae

    • Expression systems for recombinant protein

    • Assay conditions and methodology

    • Substrate preparation and purity

  • Technical analysis:

    • Develop a comparative matrix of methodologies across studies

    • Identify critical variables that differ between contradictory results

    • Replicate key experiments with standardized protocols

    • Perform direct side-by-side comparisons under identical conditions

  • Statistical reassessment:

    • Evaluate statistical power across studies

    • Consider meta-analysis where appropriate

    • Assess p-hacking or selective reporting possibilities

    • Examine effect size rather than just statistical significance

  • Biological context:

    • Consider physiological relevance of experimental conditions

    • Evaluate potential context-dependent functions

    • Assess cofactor requirements that might vary between studies

Table 4.2: Framework for Reconciling Contradictory hofD Research Findings

Contradiction TypePotential CauseResolution ApproachValidation Method
Activity level discrepancyDifferent assay conditionsSystematic condition screeningRobust statistical comparison
Substrate specificity variationSubstrate preparation differencesStandardized substrate productionCross-laboratory validation
Subcellular localizationDifferent detection methodsMultiple complementary methodsCorrelation analysis
In vivo phenotypeStrain background effectsIsogenic strain constructionGenetic complementation
Structure-function relationshipsMutation effects on protein stabilityCombined functional and structural analysisThermal shift assays

When designing experiments to resolve contradictions, researchers should prioritize transparency in methodology, pre-registration of analysis plans, and sharing of raw data to facilitate independent verification of findings.

What bioinformatic approaches can enhance functional prediction for hofD homologs?

Bioinformatic analysis provides valuable insights into hofD function, especially when applied to identify and characterize homologs across bacterial species. A comprehensive bioinformatic strategy should integrate multiple computational approaches:

  • Sequence-based analysis:

    • Profile hidden Markov models to identify distant homologs

    • Multiple sequence alignment to identify conserved residues

    • Phylogenetic analysis to track evolutionary relationships

    • Coevolution analysis to identify functional coupling

  • Structural bioinformatics:

    • Homology modeling based on related structures

    • Molecular dynamics simulations to predict functional motions

    • Binding site prediction algorithms

    • Protein-protein docking simulations with potential substrates

  • Genomic context analysis:

    • Operon structure conservation across species

    • Gene neighborhood analysis

    • Phylogenetic profiling to identify functional partners

    • Horizontal gene transfer pattern analysis

  • Integration with experimental data:

    • Correlation of sequence variations with biochemical properties

    • Machine learning approaches trained on experimental datasets

    • Network analysis incorporating protein interaction data

Table 4.3: Performance Comparison of Bioinformatic Tools for hofD Analysis

Analysis TypeToolSensitivitySpecificityComputational DemandImplementation Difficulty
Homolog detectionHMMERHighMediumLowLow
PSI-BLASTMediumLowLowLow
HHpredVery HighHighMediumMedium
Structure predictionAlphaFold2HighHighHighMedium
I-TASSERMediumMediumMediumMedium
RosettaMediumHighVery HighHigh
Function predictionInterProScanMediumHighLowLow
COFACTORHighMediumMediumMedium
DeepFRIHighMediumHighMedium
Genomic contextSTRINGHighMediumLowLow
GeCoMediumHighMediumMedium
FgenesBMediumMediumLowMedium

When implementing bioinformatic analyses, researchers should validate computational predictions with targeted experimental approaches. Cross-validation, benchmarking against known examples, and integration of multiple lines of evidence strengthen confidence in bioinformatic predictions.

How can structural biology techniques be applied to study hofD mechanism?

Structural biology provides critical insights into hofD's catalytic mechanism, substrate recognition, and membrane integration. Given the challenges associated with membrane protein structural studies, a multi-technique approach is essential for comprehensive characterization:

  • X-ray crystallography:

    • Detergent screening for optimal protein stability

    • Lipidic cubic phase crystallization for membrane proteins

    • Crystal optimization strategies (dehydration, additives)

    • Molecular replacement using related structures for phase determination

  • Cryo-electron microscopy:

    • Single-particle analysis for purified protein

    • Subtomogram averaging for in situ structural studies

    • Time-resolved experiments to capture catalytic intermediates

    • Sample preparation optimization for membrane proteins

  • Nuclear magnetic resonance (NMR):

    • Solution NMR for flexible domains

    • Solid-state NMR for membrane-embedded regions

    • Chemical shift perturbation to map substrate binding sites

    • Relaxation dispersion experiments to detect conformational dynamics

  • Small-angle X-ray scattering (SAXS):

    • Low-resolution envelope determination

    • Conformational state analysis in solution

    • Validation of crystallographic or computational models

    • Detergent micelle contribution subtraction

The experimental design should address specific structural questions related to hofD function, such as:

  • Active site architecture for both enzymatic activities

  • Conformational changes associated with substrate binding

  • Membrane topology and lipid interactions

  • Oligomerization state in the membrane

Table 5.1: Structural Information Obtained from Different Techniques for hofD

What are the best approaches for investigating hofD interactions with other bacterial proteins?

Understanding hofD's interactions with other bacterial proteins is essential for elucidating its role in type 4 pilus biogenesis and other cellular processes. A comprehensive methodological strategy should combine in vitro, in vivo, and computational approaches:

  • In vitro interaction studies:

    • Co-immunoprecipitation with tagged hofD

    • Pull-down assays using recombinant hofD as bait

    • Surface plasmon resonance for binding kinetics

    • Isothermal titration calorimetry for thermodynamic parameters

    • Crosslinking mass spectrometry to identify interaction interfaces

  • In vivo interaction mapping:

    • Bacterial two-hybrid systems

    • Fluorescence resonance energy transfer (FRET)

    • Bimolecular fluorescence complementation

    • Proximity-dependent biotin identification (BioID)

    • Co-localization studies using fluorescence microscopy

  • Computational prediction and validation:

    • Protein-protein docking simulations

    • Molecular dynamics of predicted complexes

    • Coevolution analysis to predict interaction surfaces

    • Network analysis based on genomic context

Table 5.2: Validation Strategy for hofD Protein Interactions

Interaction PartnerInitial EvidenceValidation Method 1Validation Method 2Functional Significance Test
PilD (peptidase)Co-immunoprecipitationFRET analysisBacterial two-hybridMutational analysis of interaction interface
PilC (assembly protein)Bacterial two-hybridPull-down assayCrosslinking MSCo-localization during pilus assembly
PilQ (secretin)Genomic co-occurrenceBioID proximity labelingSPR binding analysisPilus assembly defects in interaction mutants
PilT (ATPase)Predicted by structureCo-purificationSplit-GFP complementationEnergy coupling during pilus function
HofA (accessory protein)Literature suggestionAffinity chromatographyFluorescence microscopyEpistasis analysis in double mutants

When designing interaction studies, researchers should consider membrane protein-specific challenges including detergent effects on interactions, proper orientation in membrane mimetics, and potential for false positives/negatives due to hydrophobic surfaces. Controls should include non-specific binding assessments and validation across multiple methodologies.

How can systems biology approaches enhance understanding of hofD's role in bacterial physiology?

Systems biology offers powerful frameworks to integrate hofD function into the broader context of bacterial physiology and pathogenesis. A comprehensive systems approach combines high-throughput data acquisition with computational integration and modeling:

  • Multi-omics integration:

    • Transcriptomics comparing wild-type and hofD mutants

    • Proteomics to identify changes in protein abundance and post-translational modifications

    • Metabolomics to detect metabolic pathway alterations

    • Fluxomics to measure changes in metabolic flux

    • Integration of multiple data types through computational frameworks

  • Network analysis:

    • Protein-protein interaction networks centered on hofD

    • Gene regulatory networks affected by hofD mutation

    • Metabolic network perturbations

    • Signal transduction pathway mapping

  • Predictive modeling:

    • Constraint-based metabolic models

    • Ordinary differential equation models of pilus assembly

    • Agent-based models of bacterial population dynamics

    • Machine learning integration of multi-omics data

Table 6.1: Systems Biology Data Types for hofD Functional Characterization

Data TypeExperimental ApproachInformation GainedIntegration ChallengeStatistical Considerations
TranscriptomicsRNA-SeqGene expression changesConnecting mRNA to proteinMultiple testing correction
ProteomicsLC-MS/MSProtein abundance changesMembrane protein detectionMissing value imputation
PhosphoproteomicsEnrichment + LC-MS/MSSignaling pathway activationLow abundance phosphopeptidesSignal-to-noise challenges
MetabolomicsNMR or MSMetabolic consequencesMetabolite identificationPathway enrichment analysis
Fluxomics13C labeling + MSMetabolic flux alterationsMathematical modeling complexityParameter identifiability
InteractomicsAP-MS or BioIDPhysical interaction networkMembrane protein interactionsSpecificity determination

What considerations are important when developing hofD inhibitors for potential antimicrobial applications?

The development of hofD inhibitors as potential antimicrobial agents requires a methodical approach addressing target validation, screening strategies, medicinal chemistry optimization, and preclinical evaluation:

  • Target validation:

    • Essentiality confirmation through conditional knockdown

    • Assessment of virulence attenuation in hofD mutants

    • Evaluation of conservation across pathogens

    • Structural comparison with human homologs (if any)

  • Inhibitor discovery strategies:

    • High-throughput screening of compound libraries

    • Fragment-based screening using NMR or X-ray crystallography

    • Structure-based virtual screening

    • Peptide-mimetic design based on natural substrates

    • Covalent inhibitor approaches targeting active site residues

  • Assay development for screening:

    • Primary biochemical assays for both enzymatic activities

    • Counter-screens for selectivity

    • Cell-based assays measuring pilus assembly

    • Bacterial growth inhibition assays

  • Lead optimization considerations:

    • Structure-activity relationship development

    • Physiochemical property optimization

    • Pharmacokinetic parameter improvement

    • Resistance development assessment

Table 6.2: Critical Parameters for hofD Inhibitor Development

ParameterMeasurement MethodTarget ValueRationalCritical Factors
Enzymatic IC50In vitro activity assay<100 nMPotent target engagementAssay conditions mimicking in vivo
SelectivityCounter-screens>100x vs. human enzymesSafety marginAppropriate selectivity panel
Antibacterial MICBroth microdilution<8 μg/mLClinical relevanceMedia composition, inoculum
Membrane permeabilityPAMPA assay>10⁻⁶ cm/sGram-negative penetrationpH, lipid composition
Efflux liabilityMIC ratio ±inhibitor<4-fold shiftEfflux resistanceStrain selection
Resistance frequencyPassage experiments<10⁻⁸Resistance barrierMutation confirmation
CytotoxicityMammalian cell viabilityCC50 >50x MICSafety windowCell line selection

When developing hofD inhibitors, researchers should consider the challenges specific to targeting membrane proteins, including assay development complexity, potential off-target effects, and delivery of compounds to the bacterial membrane. Combination studies with existing antibiotics should be included to assess potential synergistic effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.