Recombinant Haemophilus influenzae Putative uncharacterized protein HI_1475 (HI_1475)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HI_1475; Putative uncharacterized protein HI_1475
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
HI_1475
Target Protein Sequence
MVFNMRSTRGIFSSFESGYRFASYTLELSPFKTLIKIEIPMCWKPLVCASVLAWSRAIGE FGATLMLAGATRFKTETLPMAVYLNISSGDFEIAIGASLWLLFISSCLLLVLRMINRAV
Uniprot No.

Target Background

Database Links

KEGG: hin:HI1475

STRING: 71421.HI1475

Protein Families
Binding-protein-dependent transport system permease family, CysTW subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of HI_1475 in the Haemophilus influenzae genome?

HI_1475 is a putative uncharacterized protein encoded in the Haemophilus influenzae genome. Based on comparative genomic analysis approaches, understanding the genomic context requires examination of syntenic regions and neighboring genes. Similar to other H. influenzae proteins, its genomic location can provide initial clues about function .

To determine genomic context:

  • Analyze the surrounding genes using ACT (Artemis Comparison Tool) or similar genome browsers

  • Examine if HI_1475 is part of any operon structures

  • Check for promoter elements and transcriptional regulators

  • Identify potential horizontal gene transfer signatures through GC content analysis

As demonstrated in H. influenzae genomic studies, proteins with atypical GC content (31.5%-48.5%) compared to the genome average may indicate acquisition through horizontal gene transfer . Comparative analysis with related Haemophilus species can help determine if HI_1475 is part of the core genome or a strain-specific accessory gene.

How conserved is HI_1475 across different strains of Haemophilus influenzae?

Conservation analysis of HI_1475 should employ similar methodologies to those used in comprehensive H. influenzae comparative genomics studies. Using tBlastx with a cutoff e-value ≤ 1e-5 and protein sequence similarity ≥85%, you can determine whether HI_1475 belongs to the core genome or is strain-specific .

A thorough conservation analysis would include:

H. influenzae Strain TypeProtein PresenceSequence Identity (%)Sequence Similarity (%)
Type b (Hib)To be determinedTo be determinedTo be determined
Type d (Hid)To be determinedTo be determinedTo be determined
Type f (Hif)To be determinedTo be determinedTo be determined
Nontypeable (NTHi)To be determinedTo be determinedTo be determined

This conservation pattern across strains may provide initial insights into the protein's importance for the bacterium's lifestyle and virulence potential . Additionally, comparison with other Haemophilus species (H. aegyptius, H. haemolyticus, H. parainfluenzae) could reveal evolutionary relationships similar to other H. influenzae proteins.

What computational predictions exist for HI_1475 function?

Computational prediction of HI_1475 function should utilize multiple bioinformatic approaches:

  • Sequence homology analysis using BLAST against protein databases

  • Domain and motif identification using InterPro, Pfam, and PROSITE

  • Structural prediction using AlphaFold or similar tools

  • Subcellular localization prediction with tools like PSORTb

  • Assessment of potential involvement in known pathways

This multi-tiered approach is similar to methodologies used to characterize other H. influenzae proteins, where functional predictions help guide experimental verification .

How can recombinant HI_1475 be efficiently expressed and purified for structural studies?

Expression and purification of recombinant HI_1475 requires careful optimization based on protein characteristics:

  • Expression system selection: For H. influenzae proteins, E. coli expression systems (BL21, Rosetta) are commonly used, with modifications to account for codon usage differences.

  • Vector design considerations:

    • Incorporate a suitable affinity tag (His6, GST, MBP) to facilitate purification

    • Consider using vectors with tight regulation (pET systems) to minimize toxicity

    • If membrane association is predicted, include solubilizing fusion partners

  • Expression optimization protocol:

    • Test multiple induction temperatures (16°C, 25°C, 37°C)

    • Vary IPTG concentrations (0.1-1.0 mM)

    • Evaluate different media formulations (LB, TB, auto-induction media)

    • Optimize expression duration (4 hours to overnight)

  • Purification strategy:

    • Initial capture using affinity chromatography

    • Secondary purification using ion exchange or size exclusion chromatography

    • Incorporation of reducing agents if cysteine residues are present

    • Buffer optimization based on protein stability

These approaches mirror successful strategies used for other H. influenzae proteins, where expression conditions significantly impact yield and solubility .

What techniques are optimal for investigating potential binding partners of HI_1475?

Several complementary techniques can identify binding partners of HI_1475:

  • Co-immunoprecipitation (Co-IP):

    • Generate specific antibodies against purified HI_1475

    • Perform pull-down assays from H. influenzae lysates

    • Identify interacting proteins using mass spectrometry

  • Bacterial two-hybrid system:

    • Adapt bacterial two-hybrid assays for screening protein-protein interactions

    • Use HI_1475 as bait against a library of H. influenzae proteins

  • Surface plasmon resonance (SPR) or biolayer interferometry (BLI):

    • Immobilize purified HI_1475 on sensor chips

    • Test candidate interactors based on genomic context or predictions

    • Determine binding kinetics and affinity constants

  • Cross-linking coupled with mass spectrometry:

    • Use chemical cross-linkers in live H. influenzae cells

    • Identify cross-linked peptides to map interaction interfaces

  • Functional assays based on predicted activities:

    • Design biochemical assays to test predicted enzymatic functions

    • Assess influence of potential cofactors or substrates

This multi-technique approach has proven effective for characterizing interaction networks of bacterial proteins, including those from H. influenzae .

How might HI_1475 be involved in Haemophilus influenzae virulence or stress response?

To investigate potential roles in virulence or stress response:

  • Genetic manipulation approaches:

    • Generate a clean deletion mutant of HI_1475 using methods similar to those described for tehB (using PCR products with antibiotic resistance markers flanked by homologous regions)

    • Create a complemented strain by reintroducing HI_1475 (similar to techniques used for tehB complementation)

    • Develop a conditional expression system for essential genes

  • Phenotypic characterization:

    • Test growth under various stress conditions (oxidative stress, iron limitation, temperature shifts)

    • Assess biofilm formation capabilities

    • Evaluate survival in serum and resistance to antimicrobial peptides

    • Compare growth kinetics in defined media with specific nutritional limitations

  • Transcriptomic response analysis:

    • Perform RNA-seq comparing wildtype and mutant strains under various conditions

    • Determine if HI_1475 is co-regulated with known virulence factors under iron/heme limitation (similar to tehB regulation)

  • In vivo infection models:

    • Use established animal models to compare virulence of wildtype and mutant strains

    • Assess bacterial burden in various tissues

    • Measure host immune responses

This systematic approach parallels strategies used to characterize virulence roles of other H. influenzae proteins, where iron/heme-responsive genes often contribute to pathogenesis .

What are the best strategies for generating a clean deletion of HI_1475 in Haemophilus influenzae?

Creating a clean deletion mutant of HI_1475 requires specific considerations for H. influenzae genetics:

  • Mutagenic construct design:

    • Amplify approximately 1 kb upstream and downstream of HI_1475

    • Incorporate restriction sites for joining fragments and inserting antibiotic markers

    • Create a fusion PCR product combining upstream region, antibiotic resistance cassette, and downstream region

  • Transformation protocol:

    • Make H. influenzae competent using the MIV medium method described by Poje & Redfield

    • Transform with the mutagenic construct via natural competence

    • Select transformants on appropriate antibiotic-containing media

  • Mutant verification:

    • PCR verification of correct chromosomal arrangement

    • RT-PCR confirmation of absence of HI_1475 transcription

    • Whole-genome sequencing to confirm the absence of additional mutations

  • Complementation strategy:

    • Create a complementation construct by cloning HI_1475 with native promoter into a vector like pASK5, which allows insertion into the non-essential OmpP1 locus

    • Transform the deletion mutant with this construct

    • Verify correct integration and expression

This approach follows established protocols for creating defined mutations in H. influenzae, ensuring precise genetic manipulation for subsequent functional studies .

How can transcriptional regulation of HI_1475 be studied under different environmental conditions?

Studying transcriptional regulation of HI_1475 involves several complementary approaches:

  • qRT-PCR analysis:

    • Design specific primers for HI_1475

    • Expose H. influenzae to various conditions (iron/heme limitation, oxidative stress, nutrient restriction)

    • Extract RNA and perform qRT-PCR to measure expression changes

    • Use appropriate reference genes for normalization

  • Promoter fusion studies:

    • Clone the HI_1475 promoter region upstream of a reporter gene (e.g., lacZ, gfp)

    • Integrate this construct into H. influenzae chromosome

    • Measure reporter activity under different conditions

    • Identify minimal promoter elements through deletion analysis

  • Transcription start site mapping:

    • Use 5' RACE or RNA-seq to precisely map transcription start sites

    • Identify potential regulatory elements in the promoter region

    • Perform DNase I footprinting to identify protein binding regions

  • Regulator identification:

    • Perform DNA pull-down assays using the HI_1475 promoter region

    • Identify bound proteins by mass spectrometry

    • Confirm interactions with electrophoretic mobility shift assays (EMSA)

Similar methodologies have successfully identified iron-responsive regulation of H. influenzae genes, including tehB, which showed increased transcription during growth in iron- and haem-restricted media .

What approaches can be used to determine the subcellular localization of HI_1475?

Determining the subcellular localization of HI_1475 requires multiple complementary techniques:

  • Fluorescent protein fusion:

    • Create C- and N-terminal fluorescent protein fusions (GFP, mCherry)

    • Introduce these constructs into H. influenzae

    • Visualize localization using fluorescence microscopy

    • Ensure the fusion doesn't disrupt protein function through complementation testing

  • Subcellular fractionation:

    • Separate H. influenzae into cytoplasmic, membrane, and periplasmic fractions

    • Detect native HI_1475 using specific antibodies

    • Verify fraction purity using marker proteins for each compartment

  • Immunogold electron microscopy:

    • Generate specific antibodies against purified HI_1475

    • Process H. influenzae cells for electron microscopy

    • Detect HI_1475 using gold-labeled secondary antibodies

    • Quantify gold particle distribution across cellular compartments

  • Protease accessibility assays:

    • Treat intact cells with proteases that cannot penetrate the outer membrane

    • Assess HI_1475 degradation to determine surface exposure

    • Use spheroplasts to evaluate periplasmic localization

This multi-method approach has been effective for determining localization of other H. influenzae proteins, helping to establish their functional contexts .

How should conflicting experimental results regarding HI_1475 function be reconciled?

When faced with conflicting experimental results regarding HI_1475 function:

  • Systematic validation:

    • Repeat key experiments with additional controls

    • Verify reagent quality and specificity (antibodies, primers, constructs)

    • Ensure strain backgrounds are consistent and verified

    • Consider independent validation in collaborative laboratories

  • Condition-dependent effects analysis:

    • Evaluate if discrepancies arise from subtle differences in experimental conditions

    • Test a broader range of conditions to identify context-dependent functions

    • Assess growth phase-dependent effects

  • Multi-faceted functional analysis:

    • Consider that HI_1475 may have multiple distinct functions (moonlighting)

    • Separate direct from indirect effects through careful genetic analysis

    • Create point mutants to dissect domain-specific functions

  • Data integration approach:

    • Develop a unified model that accommodates seemingly contradictory results

    • Weight evidence based on methodological strengths and reproducibility

    • Use computational modeling to test if multiple functions are compatible

Similar approaches have resolved functional discrepancies for other bacterial proteins, including dual-function proteins in H. influenzae that show condition-dependent activities .

What statistical approaches are most appropriate for analyzing HI_1475 mutant phenotypes in varying conditions?

When analyzing phenotypic data from HI_1475 mutants:

  • Experimental design considerations:

    • Include biological replicates (minimum n=3) for all experiments

    • Use technical replicates to account for measurement variation

    • Include appropriate controls (wild-type, complemented mutant, media controls)

    • Consider batch effects in experimental planning

  • Statistical tests selection:

    • For comparing two conditions: Student's t-test or Mann-Whitney U test depending on normality

    • For multiple conditions: ANOVA with appropriate post-hoc tests (Tukey's, Dunnett's)

    • For growth curves: mixed-effects models or area under the curve (AUC) analysis

    • For survival data: Kaplan-Meier analysis with log-rank test

  • Data visualization:

    • Present individual data points alongside means and error bars

    • Use consistent scales when comparing across conditions

    • Indicate statistical significance clearly

  • Advanced analysis for complex datasets:

    • Principal component analysis for multivariate phenotypic data

    • Hierarchical clustering to identify condition groups with similar effects

    • Machine learning approaches to identify predictive phenotypic signatures

These statistical approaches have been successfully applied in studies of H. influenzae gene function, including analysis of tehB mutant phenotypes in various growth conditions and infection models .

How can structural data be integrated with functional studies to understand the molecular mechanism of HI_1475?

Integrating structural and functional data for HI_1475 requires a coordinated approach:

  • Structure-guided mutagenesis:

    • Use structural prediction or experimental structures to identify critical residues

    • Create single amino acid substitutions targeting:

      • Putative active sites

      • Potential binding interfaces

      • Structural elements (e.g., hinges between domains)

    • Assess the impact of mutations on all identified functions

  • Ligand binding site identification:

    • Use computational docking to predict potential ligands

    • Perform thermal shift assays to screen for stabilizing ligands

    • Use NMR or X-ray crystallography with bound ligands to confirm binding sites

  • Conformational dynamics analysis:

    • Employ hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map dynamic regions

    • Use molecular dynamics simulations to predict conformational changes

    • Correlate dynamic regions with functional data

  • Data integration framework:

    • Create a structural-functional map linking specific structural elements to functions

    • Develop a mechanistic model explaining how structural changes relate to activity

    • Use this model to design targeted experiments for further validation

This integrated approach has proven valuable for other bacterial proteins, including S-adenosyl methyltransferases like TehB in H. influenzae, where structural features directly inform mechanistic understanding of function .

What methodologies are optimal for assessing the potential of HI_1475 as a therapeutic target?

Evaluating HI_1475 as a therapeutic target requires systematic assessment:

  • Essentiality determination:

    • Attempt construction of clean deletion mutants in multiple strains

    • If unsuccessful, develop conditional expression systems to confirm essentiality

    • Use CRISPRi or antisense RNA approaches as alternatives

  • Druggability assessment:

    • Analyze the protein structure for potential binding pockets

    • Perform fragment-based screening to identify chemical starting points

    • Assess the conservation of potential binding sites across strains and species

  • Inhibitor screening strategy:

    • Develop biochemical assays based on demonstrated HI_1475 function

    • Establish cell-based reporter systems for high-throughput screening

    • Create counter-screens to ensure specificity

  • Target validation:

    • Demonstrate that chemical inhibition phenocopies genetic deletion

    • Confirm molecular engagement using cellular thermal shift assays (CETSA)

    • Evaluate resistance development frequency and mechanisms

This methodical approach has been used for other H. influenzae proteins, where detailed functional characterization preceded therapeutic targeting efforts .

How can HI_1475 be evaluated in the context of Haemophilus influenzae pathogenesis?

To evaluate HI_1475's role in pathogenesis:

  • Infection model selection:

    • Choose appropriate animal models based on infection site and type

    • Consider both colonization and invasive disease models

    • Use human cell culture models for specific interactions

  • In vivo competition assays:

    • Co-infect with wild-type and HI_1475 mutant strains

    • Calculate competitive indices in different tissues

    • Track bacterial burden over time

  • Host response analysis:

    • Measure inflammatory markers during infection

    • Assess tissue damage and bacterial clearance

    • Compare immune cell recruitment and activation

  • Transcriptional profiling during infection:

    • Perform dual RNA-seq to capture both bacterial and host responses

    • Identify infection-specific regulation of HI_1475

    • Map HI_1475-dependent effects on global gene expression

This approach parallels studies of other H. influenzae virulence factors, where rat models of infection revealed that the tehB gene is required for wild-type levels of infection in invasive disease models .

What are the most significant challenges in studying putative uncharacterized proteins like HI_1475?

Investigating uncharacterized proteins like HI_1475 presents several significant challenges:

  • Functional prediction limitations:

    • Sequence-based predictions may be unreliable for novel protein families

    • Structural predictions might have higher uncertainty without close homologs

    • Absence of characterized domains complicates functional assignment

  • Experimental design complexity:

    • Without functional hypotheses, experimental approaches must be broad

    • Negative results are difficult to interpret (absence of function vs. inadequate conditions)

    • Determining physiologically relevant conditions is challenging

  • Technical obstacles:

    • Expression and purification of proteins with unknown properties can be difficult

    • Generating specific antibodies without structural information is challenging

    • Establishing appropriate assays without functional clues requires extensive optimization

  • Data interpretation challenges:

    • Distinguishing primary from secondary effects in mutant phenotypes

    • Determining if observed in vitro activities are physiologically relevant

    • Integrating disparate experimental results into a coherent model

Despite these challenges, systematic approaches combining genomic context analysis, structural studies, and phenotypic characterization have successfully illuminated functions of previously uncharacterized proteins in H. influenzae .

How should future research directions for HI_1475 be prioritized?

Prioritizing future research on HI_1475 should follow a strategic approach:

  • High-priority immediate investigations:

    • Determine conservation across strains and species to establish evolutionary significance

    • Generate clean deletion mutants to assess essentiality and basic phenotypes

    • Establish subcellular localization to narrow functional hypotheses

    • Determine if expression is regulated by key environmental factors (iron, oxygen, pH)

  • Medium-priority investigations:

    • Identify potential binding partners through unbiased approaches

    • Solve or predict protein structure to guide functional studies

    • Assess impact on host-pathogen interactions in cellular models

    • Characterize biochemical activities based on structural features

  • Long-term research directions:

    • Evaluate therapeutic potential if functional importance is established

    • Integrate into systems biology models of H. influenzae metabolism or virulence

    • Explore potential as a diagnostic or vaccine target if surface-exposed

    • Investigate evolutionary implications across the Pasteurellaceae family

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.