Recombinant Haemophilus influenzae Putative uncharacterized symporter HI_1315 (HI_1315)

Shipped with Ice Packs
In Stock

Description

Molecular and Recombinant Characteristics

HI_1315 is a full-length protein (1–105 amino acids) with no established functional annotation. Recombinant versions are produced in E. coli fused with an N-terminal His-tag for purification . Key specifications include:

PropertyValue
UniProt IDP71375
Gene NameHI_1315
SpeciesHaemophilus influenzae (strain Rd Kw-20)
Expression HostE. coli
Purity>90% (SDS-PAGE) , >85% (partial version)
TagHis-tag
FormLyophilized powder , liquid (partial)
Storage-20°C/-80°C (long-term), 4°C (short-term working aliquots)

The partial recombinant version (CSB-EP303252HTA1-B) excludes specific regions, though sequence details are not disclosed .

Functional Context and Research Gaps

  • Tripartite ATP-Independent Transporters (TRAPs): H. influenzae employs TRAPs (e.g., sialic acid transporters) distinct from ABC transporters or major facilitator superfamily (MFS) proteins like E. coli NanT . HI_1315 does not align with known TRAP components .

  • Na+/I− Symporters: Structural studies of human NIS reveal conserved motifs (e.g., LeuT-fold domains) critical for substrate binding and translocation . No homologous structural data exist for HI_1315.

Key Research Gaps:

  1. Substrate specificity (e.g., sugars, ions, or organic molecules).

  2. Ion dependence and transport mechanism (e.g., Na⁺, H⁺, or K⁺ symport).

  3. Role in H. influenzae pathogenicity or metabolic pathways.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its inclusion in the development process.
Synonyms
HI_1315; Putative uncharacterized symporter HI_1315
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-105
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
HI_1315
Target Protein Sequence
MLVDMGEQYMLTTILSFLIVTTVVAYVSWLKTKGDDLKSSKGYFLAGRGLSGLVIGCSMV LTSLSTEQLIGVNAVSYKGNFSVIAWTVPTVIPLCFLALYIIGWL
Uniprot No.

Target Background

Database Links

KEGG: hin:HI1315

STRING: 71421.HI1315

Protein Families
Sodium:solute symporter (SSF) (TC 2.A.21) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Haemophilus influenzae and why are its uncharacterized proteins scientifically significant?

Haemophilus influenzae is a gram-negative bacterium commonly found in the nose and throat of children and adults. While some individuals can carry the bacteria without becoming ill, the organism can cause various serious infections including meningitis, bacteremia, pneumonia, and septic arthritis . Uncharacterized proteins from H. influenzae, such as the putative symporter HI_1315, are scientifically significant because they represent potential targets for understanding bacterial pathogenesis, developing novel antimicrobial therapies, and elucidating previously unknown cellular transport mechanisms. Research into these proteins contributes to our fundamental knowledge of bacterial physiology and may lead to breakthroughs in treating H. influenzae infections, which are particularly concerning in unvaccinated children, the elderly, and immunocompromised populations .

What are the basic approaches for studying an uncharacterized symporter like HI_1315?

The study of an uncharacterized symporter like HI_1315 typically begins with sequence analysis to identify conserved domains and predict potential functions based on homology with characterized proteins. This is followed by recombinant protein expression and purification, which allows for structural studies (such as X-ray crystallography or cryo-EM) to determine the three-dimensional configuration of the protein. Functional characterization involves transport assays to identify substrate specificity, kinetics analysis to understand transport mechanisms, and mutagenesis studies to pinpoint critical residues for function. Biochemical approaches such as circular dichroism spectroscopy help determine secondary structure compositions, while techniques like isothermal titration calorimetry can measure binding affinities to potential substrates . These methodologies should be implemented within a controlled experimental design framework, where independent variables (such as substrate concentration or pH) are systematically manipulated to observe effects on dependent variables (such as transport rate) .

How should I design initial experiments to characterize the function of HI_1315?

The initial experimental design for characterizing HI_1315 should follow a systematic approach:

  • Hypothesis Formulation: Based on bioinformatic predictions, formulate testable hypotheses about the protein's potential substrates and transport mechanism .

  • Variable Definition: Clearly identify independent variables (e.g., substrate types, concentrations, environmental conditions) and dependent variables (e.g., transport rates, binding affinities) .

  • Controls Implementation: Include positive controls (known symporters with similar predicted functions) and negative controls (non-functional mutants or unrelated proteins) .

  • Experimental Conditions: Design experiments with varying conditions to test the protein's function across a range of physiologically relevant parameters.

  • Methodology Selection: Choose appropriate techniques based on predicted function, such as:

TechniquePurposeData Output
Substrate uptake assaysDetermine transport functionTransport rates, substrate specificity
Membrane potential measurementsAssess energy couplingChanges in membrane potential during transport
pH sensitivity assaysIdentify proton couplingTransport activity vs. pH curves
Site-directed mutagenesisIdentify functional residuesActivity comparison between wild-type and mutants

This methodical approach ensures that initial characterization provides a solid foundation for more advanced functional studies .

How should I optimize the expression and purification of recombinant HI_1315 for functional studies?

Optimizing expression and purification of recombinant HI_1315 requires a systematic experimental design approach with careful consideration of multiple variables:

  • Expression System Selection: Test multiple expression systems (E. coli, yeast, mammalian cells) to determine optimal protein yield and functionality. For membrane proteins like symporters, specialized E. coli strains such as C41(DE3) or C43(DE3) often provide better results .

  • Construct Design: Implement a factorial experimental design testing different constructs:

    • Full-length protein vs. truncated versions

    • Various affinity tags (His, GST, MBP) at different positions (N-terminal, C-terminal)

    • Inclusion of cleavage sites for tag removal

  • Expression Conditions: Systematically vary the following parameters:

ParameterVariables to TestExpected Effect
Temperature16°C, 25°C, 30°C, 37°CLower temperatures may reduce inclusion body formation
Induction timingEarly log, mid-log, late log phaseAffects protein folding efficiency
Inducer concentration0.1-1.0 mM IPTG for E. coliOptimal concentration balances yield and toxicity
Media compositionLB, TB, 2XYT, minimal mediaDifferent media affect expression levels
AdditivesGlycerol, sorbitol, chaperone co-expressionMay improve protein folding
  • Purification Strategy: Implement a multi-step purification process, typically beginning with affinity chromatography followed by size exclusion chromatography. Each step should be optimized individually, testing various buffers, detergents (for membrane proteins), and pH conditions .

  • Quality Control: Assess protein purity, homogeneity, and functional state through SDS-PAGE, Western blotting, size exclusion chromatography profiles, and initial functional assays.

This methodical approach, following good experimental design principles with appropriate controls, will help determine the optimal conditions for obtaining functional HI_1315 protein .

What are the key considerations when designing experiments to identify substrates transported by HI_1315?

When designing experiments to identify substrates transported by HI_1315, consider these critical factors:

  • Hypothesis-Driven Approach: Formulate clear hypotheses based on:

    • Bioinformatic predictions from sequence homology

    • Genomic context of the HI_1315 gene

    • Metabolic pathways present in H. influenzae

    • Transport systems previously characterized in related bacteria

  • Experimental Setup Design:

    • Control Groups: Include positive controls (known transporters) and negative controls (transport-deficient mutants, unrelated membrane proteins)

    • Variable Manipulation: Systematically test potential substrates across concentration ranges

    • Randomization: Randomize testing order to prevent systematic bias

    • Biological Replicates: Perform at least three independent experiments to ensure reproducibility

  • Substrate Selection Strategy:

    • Begin with broad substrate classes (sugars, amino acids, ions, etc.)

    • Narrow down to specific compounds within identified classes

    • Consider physiologically relevant substrates based on H. influenzae ecology and metabolism

  • Transport Assay Methodology:

TechniqueAdvantagesLimitationsData Output
Radioisotope uptakeHigh sensitivity, quantitativeRequires radioactive materialsDirect measurement of transport kinetics
Fluorescent substrate analogsReal-time monitoring, no radioactivityLimited substrate optionsTransport visualization in living cells
Counterflow assaysIdentifies exchange substratesComplex setupSubstrate specificity profile
Electrophysiological methodsDetects electrogenic transportTechnical complexityElectrical characteristics of transport
Growth complementationPhysiological relevanceLimited to essential substratesFunctional transport in vivo
  • Data Analysis Plan:

    • Statistical methods to determine significance

    • Kinetic analysis for transport parameters (Km, Vmax)

    • Controls for non-specific binding versus actual transport

By implementing this systematic approach, researchers can effectively identify and characterize the substrate profile of the putative symporter HI_1315, generating reliable and reproducible results that advance understanding of this uncharacterized protein .

How should complex multi-factor experiments be designed when studying the regulation of HI_1315 expression?

Designing complex multi-factor experiments for studying HI_1315 regulation requires a sophisticated approach:

Factor CategoryVariables to ControlMeasurement Approach
Transcriptional regulationPromoter activityReporter gene assays (luciferase, GFP)
Post-transcriptionalmRNA stabilityRT-qPCR, RNA-seq, northern blotting
TranslationalProtein synthesis ratePulse-chase labeling, ribosome profiling
Post-translationalProtein stability, modificationWestern blotting, mass spectrometry
  • Advanced Statistical Analysis Plan:

    • ANOVA to evaluate significance of multiple factors

    • Multiple regression to model relationships between variables

    • Principal component analysis to reduce dimensionality

    • Machine learning approaches for complex pattern recognition

  • Validation Strategy:

    • Independent verification experiments

    • Different methodological approaches to confirm findings

    • In vivo confirmation of in vitro findings

    • Cross-validation across different H. influenzae strains

This comprehensive approach allows researchers to untangle complex regulatory networks affecting HI_1315 expression while maintaining rigorous experimental control and statistical validity .

How should I approach unexpected or contradictory data when characterizing HI_1315 function?

When encountering unexpected or contradictory data during HI_1315 characterization, implement this structured approach:

  • Data Verification Phase:

    • Reproduce the experiment with increased replication to confirm the unexpected result is genuine

    • Review methodology for potential errors or inconsistencies in experimental protocols

    • Check instrument calibration and reagent quality/stability

    • Verify positive and negative controls performed as expected

  • Critical Analysis of Initial Assumptions:

    • Reassess the hypothesis in light of new data

    • Review literature for similar contradictory findings in related proteins

    • Consult with colleagues for fresh perspectives on data interpretation

  • Alternative Hypothesis Development:

    • Consider whether HI_1315 might:

      • Transport multiple substrates with differing affinities

      • Function as part of a larger protein complex

      • Require specific cellular conditions for activation

      • Have regulatory functions beyond simple transport

  • Methodological Adaptation:

    • Modify experimental approaches to test new hypotheses

    • Implement orthogonal techniques to validate findings from multiple angles

    • Refine variables and controls to address potential confounding factors

  • Data Reconciliation Framework:

Type of ContradictionPotential ExplanationInvestigation Approach
Substrate specificity inconsistencyAllosteric regulationTest with various effector molecules
Activity varies between preparationsProtein conformation differencesCircular dichroism and thermal stability analysis
In vitro vs. in vivo discrepancyMissing cellular componentsReconstitution with membrane extracts or liposomes
Conflicting kinetic parametersMultiple binding sitesDetailed binding studies with concentration series
Unexpected inhibitor effectsOff-target interactionsSpecificity profiling and structure-activity relationships

Remember that unexpected results often lead to the most significant scientific discoveries. Approach contradictory data as an opportunity to develop novel insights about HI_1315 function rather than as experimental failures .

What statistical approaches are most appropriate for analyzing transport kinetics data for HI_1315?

When analyzing transport kinetics data for HI_1315, employ these statistical approaches:

  • Kinetic Model Fitting:

    • Michaelis-Menten equations for simple transport kinetics:
      V=Vmax×[S]Km+[S]V = \frac{V_{max} \times [S]}{K_m + [S]}

    • Hill equation for cooperative binding:
      V=Vmax×[S]nK0.5n+[S]nV = \frac{V_{max} \times [S]^n}{K_{0.5}^n + [S]^n}

    • Competitive inhibition models when studying inhibitors:
      V=Vmax×[S]Km(1+[I]Ki)+[S]V = \frac{V_{max} \times [S]}{K_m(1 + \frac{[I]}{K_i}) + [S]}

  • Regression Analysis Methods:

    • Non-linear regression for fitting transport kinetics models

    • Lineweaver-Burk, Eadie-Hofstee, or Hanes-Woolf plots for visual analysis of kinetic parameters

    • Global fitting when analyzing multiple datasets simultaneously

  • Statistical Validation:

    • Residual analysis to assess goodness of fit

    • F-test for comparing nested models

    • Akaike Information Criterion (AIC) for model selection

    • Bootstrap analysis for parameter confidence intervals

  • Experimental Design Considerations for Robust Statistics:

    • Ensure sufficient data points across the substrate concentration range

    • Include technical and biological replicates (minimum n=3)

    • Incorporate appropriate controls for non-specific binding

    • Design experiments to minimize systematic errors

  • Advanced Analysis for Complex Transport Mechanisms:

Transport MechanismStatistical ApproachKey Parameters
Simple symportMichaelis-MentenKm, Vmax
Multi-substrate transportBi-substrate kineticsKm for each substrate, interaction factors
pH-dependent transport3D surface fittingKm, Vmax as functions of pH
Electrogenic transportCurrent-voltage analysisReversal potential, conductance
Cooperative transportHill equation analysisHill coefficient, K0.5
  • Software Tools:

    • GraphPad Prism for kinetic analysis

    • R with specialized packages (drc, nlme) for complex models

    • Python with SciPy for custom model development

    • MATLAB for surface fitting and global analysis

By applying these rigorous statistical approaches, researchers can extract meaningful kinetic parameters from transport data and develop accurate models of HI_1315 function that distinguish between different transport mechanisms .

How should I design experiments to distinguish between active transport and facilitated diffusion mechanisms for HI_1315?

Designing experiments to distinguish between active transport and facilitated diffusion for HI_1315 requires sophisticated approaches:

  • Energy Dependence Assays:

    • ATP Depletion: Use metabolic inhibitors (oligomycin, 2-deoxyglucose) to deplete cellular ATP and observe effects on transport rates

    • Ionophore Application: Apply protonophores (CCCP, DNP) or ionophores (valinomycin) to dissipate electrochemical gradients

    • Temperature Dependency: Compare transport rates at various temperatures to calculate activation energy (higher for active transport)

  • Concentration Gradient Experiments:

Experimental DesignActive TransportFacilitated DiffusionData Analysis Approach
Transport against gradientPossibleNot possibleMeasure internal vs. external substrate ratios at equilibrium
Saturation kineticsPresentPresentCompare Km and Vmax parameters
CounterflowMay be presentAlways presentMeasure exchange rates with preloaded substrates
Effect of metabolic inhibitorsSignificant inhibitionMinimal effectCalculate percent inhibition with ATP depletion
  • Thermodynamic Analysis:

    • Measure transport at varying extracellular/intracellular substrate ratios

    • Calculate free energy changes during transport

    • Compare with ATP hydrolysis energy or ion gradient potential

    • Determine stoichiometry between substrate and coupling ions

  • Electrophysiological Approaches:

    • Use patch-clamp techniques to measure current generated during transport

    • Determine reversal potentials at different substrate concentrations

    • Analyze current-voltage relationships to identify electrogenic steps

    • Calculate charge:substrate stoichiometry

  • Statistical Design Considerations:

    • Implement factorial designs testing multiple conditions simultaneously

    • Use appropriate controls for membrane integrity and cell viability

    • Perform rigorous statistical analysis (ANOVA, regression analysis)

    • Calculate confidence intervals for key transport parameters

By systematically implementing these experimental approaches with proper controls and statistical analysis, researchers can definitively distinguish between active and passive transport mechanisms for HI_1315, providing crucial insights into its physiological role and energy requirements .

What approaches should be used to investigate the role of HI_1315 in Haemophilus influenzae pathogenesis?

Investigating HI_1315's role in Haemophilus influenzae pathogenesis requires a multifaceted approach:

  • Genetic Manipulation Strategies:

    • Gene Knockout: Create HI_1315 deletion mutants using homologous recombination

    • Conditional Expression: Develop inducible expression systems to control HI_1315 levels

    • Point Mutations: Generate site-specific mutations in functional domains

    • Complementation Studies: Restore function with wild-type HI_1315 to confirm phenotypes

  • Virulence Assessment Framework:

Model SystemMeasurementsAdvantagesLimitations
Cell culture infectionsAdhesion, invasion, survival ratesControlled conditions, specific cell responsesLacks complexity of whole organism
Animal infection modelsColonization, disease progression, mortalityPhysiological relevance, immune responseEthical considerations, species differences
Ex vivo human tissueTissue damage, inflammatory responseHuman relevance, tissue-specific effectsLimited availability, donor variability
Biofilm formationBiofilm density, antibiotic resistanceMimics natural growth stateMay not reflect all virulence aspects
  • Expression Analysis During Infection:

    • Transcriptomics: RNA-seq to measure HI_1315 expression during different infection stages

    • Proteomics: Mass spectrometry to quantify protein levels and modifications

    • In vivo Expression Technology (IVET): Identify infection-induced expression

    • Single-cell Analysis: Examine expression heterogeneity within bacterial populations

  • Substrate Identification in Host Context:

    • Metabolomic Profiling: Compare metabolites in wild-type vs. HI_1315 mutants during infection

    • Isotope Labeling: Track substrate utilization with labeled compounds

    • Bioinformatic Prediction: Analyze potential substrates relevant to host environments

    • Transport Assays: Test candidate substrates under infection-relevant conditions

  • Host Response Analysis:

    • Immunological Profiling: Measure cytokine/chemokine responses to wild-type vs. mutant bacteria

    • Transcriptome Analysis: Compare host gene expression changes

    • Histopathological Assessment: Evaluate tissue damage and inflammatory infiltrate

    • Survival Studies: Monitor infection outcomes in appropriate models

  • Statistical and Experimental Design Considerations:

    • Use sufficient biological replicates (minimum n=5 for animal studies)

    • Include appropriate controls (wild-type, complemented mutants)

    • Implement blinding procedures for outcome assessment

    • Apply appropriate statistical tests with corrections for multiple comparisons

This comprehensive approach enables researchers to establish causal relationships between HI_1315 function and H. influenzae pathogenesis, potentially identifying new therapeutic targets for treating infections .

How can I design experiments to determine if HI_1315 functions as part of a larger protein complex or transport system?

Designing experiments to investigate HI_1315's potential role in protein complexes requires a multi-technique approach:

  • Protein-Protein Interaction Screening:

    • Co-immunoprecipitation (Co-IP): Pull down HI_1315 and identify interacting partners using mass spectrometry

    • Bacterial Two-Hybrid (B2H): Screen for direct protein-protein interactions

    • Proximity Labeling: Use BioID or APEX2 fusions to identify proteins in close proximity

    • Cross-linking Mass Spectrometry (XL-MS): Identify interaction interfaces between complex components

  • Functional Complex Analysis:

TechniqueInformation ProvidedExperimental Design Considerations
Blue Native PAGENative complex size, subunit compositionCompare complex formation under different growth conditions
Size Exclusion ChromatographyComplex stability, stoichiometryAnalyze different detergent/buffer conditions for optimal complex isolation
Analytical UltracentrifugationComplex homogeneity, stoichiometryDesign multiple sedimentation velocity and equilibrium experiments
Cryo-EMStructural arrangement of the complexPrepare samples in various functional states (e.g., with/without substrate)
FRETDynamic association in living cellsDesign constructs with appropriate fluorophore placement and controls
  • Genetic Approaches to Complex Function:

    • Co-expression Analysis: Examine coordinated expression of HI_1315 and potential partners

    • Synthetic Genetic Arrays: Identify genetic interactions through epistasis analysis

    • Operon Structure Analysis: Determine if HI_1315 is co-transcribed with other genes

    • Suppressor Mutation Screening: Identify mutations that rescue HI_1315 mutant phenotypes

  • Functional Reconstitution Studies:

    • Purification of Component Proteins: Express and purify potential complex components

    • In Vitro Complex Assembly: Reconstitute the complex with defined components

    • Liposome Reconstitution: Incorporate the complex into liposomes for functional assays

    • Activity Comparison: Compare activity of individual HI_1315 vs. reconstituted complex

  • Advanced Structural Biology Approaches:

    • Integrative Structural Modeling: Combine data from multiple structural techniques

    • Hydrogen-Deuterium Exchange MS: Map protein interaction surfaces

    • Single-Particle Tracking: Analyze complex dynamics in living cells

    • In-cell NMR: Study complex formation in physiological environments

  • Experimental Design Considerations:

    • Include appropriate negative controls (unrelated membrane proteins)

    • Validate interactions through multiple orthogonal techniques

    • Consider the impact of detergents and buffer conditions on complex stability

    • Design experiments to capture transient or weak interactions

By systematically implementing this experimental framework, researchers can determine whether HI_1315 functions independently or as part of a larger transport complex, providing crucial insights into its physiological role and mechanism of action .

What are the most effective approaches for developing structure-based inhibitors of HI_1315 transport function?

Developing structure-based inhibitors of HI_1315 requires a systematic approach combining computational and experimental methods:

  • Structure Determination and Refinement:

    • Homology Modeling: Generate initial structural models based on related transporters

    • Molecular Dynamics Simulations: Refine models and identify binding pocket dynamics

    • Fragment-Based Screening: Identify small molecules that bind to potential active sites

    • Advanced Structural Biology: Pursue X-ray crystallography or cryo-EM for high-resolution structures when possible

  • Virtual Screening Workflow:

    • Binding Site Identification: Use computational algorithms to identify potential inhibitor binding sites

    • Molecular Docking: Screen large compound libraries against identified binding sites

    • Pharmacophore Modeling: Identify key features required for binding

    • Quantitative Structure-Activity Relationship (QSAR): Develop predictive models of inhibitor potency

  • Iterative Optimization Framework:

PhaseTechniquesExperimental Design Considerations
Hit IdentificationHigh-throughput transport assays, Fragment screeningInclude diverse chemical scaffolds, use statistical design to maximize coverage
Hit ValidationDose-response curves, Binding assays (SPR, ITC)Multiple orthogonal techniques, careful statistical analysis
Lead OptimizationStructure-activity relationship studiesSystematic modification of hit compounds, factorial design to explore chemical space
Selectivity ProfilingCounter-screening against related transportersInclude human orthologs to assess potential off-target effects
  • Structure-Function Correlation Studies:

    • Site-Directed Mutagenesis: Validate predicted binding sites through mutation

    • Photoaffinity Labeling: Identify actual binding sites of promising inhibitors

    • Hydrogen-Deuterium Exchange: Map conformational changes upon inhibitor binding

    • Thermal Shift Assays: Measure stabilization effects of inhibitors

  • Advanced Computational Techniques:

    • Free Energy Perturbation: Calculate binding affinities more accurately

    • Metadynamics: Identify cryptic binding sites and conformational states

    • Machine Learning Models: Predict binding affinities and optimize compounds

    • Network Pharmacology: Identify potential synergistic inhibitor combinations

  • Experimental Validation in Biological Context:

    • Whole-Cell Transport Assays: Verify inhibitor efficacy in cellular context

    • Growth Inhibition Studies: Determine if transport inhibition affects bacterial viability

    • Resistance Development Monitoring: Assess potential for resistance evolution

    • Infection Model Testing: Evaluate efficacy in relevant infection models

By implementing this integrated approach, researchers can develop potent and selective inhibitors of HI_1315, potentially leading to novel therapeutics against Haemophilus influenzae infections .

What experimental approaches are most effective for studying the regulation of HI_1315 expression under different environmental conditions?

Studying HI_1315 expression regulation across environmental conditions requires a comprehensive methodological approach:

  • Transcriptional Regulation Analysis:

    • Promoter Mapping: Use 5' RACE and primer extension to identify transcription start sites

    • Reporter Gene Assays: Fuse promoter regions to luciferase or GFP to measure activity

    • Electrophoretic Mobility Shift Assays (EMSA): Identify proteins binding to regulatory regions

    • ChIP-seq: Map genome-wide binding of transcription factors that regulate HI_1315

  • Environmental Response Characterization:

Environmental ConditionExperimental ApproachData Collection MethodAnalysis Strategy
Nutrient limitationGrowth in defined media with limited resourcesRT-qPCR, RNA-seq, proteomicsCorrelation analysis with growth rate
pH stressGrowth in buffered media at various pHTime-course expression analysisIdentify pH threshold for expression changes
Oxygen levelsAerobic, microaerobic, anaerobic growthWestern blotting, activity assaysCompare expression across oxygen gradients
Temperature variationGrowth at different temperaturesReporter assays, proteomicsCalculate temperature coefficients
Host-relevant conditionsTissue culture models, ex vivo systemsIn situ hybridization, IFASpatial expression analysis
  • Post-transcriptional Regulation Studies:

    • mRNA Stability Assays: Measure transcript half-life using transcription inhibitors

    • RNA Structure Probing: Identify regulatory RNA structures using chemical probing

    • RNA-Protein Interaction Studies: RNA immunoprecipitation to identify regulatory proteins

    • Ribosome Profiling: Assess translational efficiency under different conditions

  • Experimental Design Considerations:

    • Factorial Design: Systematically test combinations of environmental factors

    • Time-Course Analysis: Capture dynamic regulation over time

    • Single-Cell Approaches: Address population heterogeneity in expression

    • Integration of Multi-omics Data: Combine transcriptomics, proteomics, and metabolomics

  • Statistical Analysis Framework:

    • Multivariate Analysis: Identify key environmental factors affecting expression

    • Principal Component Analysis: Reduce dimensionality of complex datasets

    • Hierarchical Clustering: Group conditions with similar expression patterns

    • Network Analysis: Reconstruct regulatory networks controlling HI_1315

  • Validation in Physiologically Relevant Context:

    • Animal Infection Models: Verify expression patterns during in vivo infection

    • Human Tissue Explants: Test expression in ex vivo human airway tissue

    • Patient Sample Analysis: When ethically possible, analyze expression in clinical isolates

    • Ecological Niche Simulation: Recreate environmental conditions from natural habitats

This methodical approach provides a comprehensive understanding of how environmental factors influence HI_1315 expression, offering insights into its role in H. influenzae adaptation to different niches and potentially identifying conditions where it becomes critical for bacterial survival .

How can I develop high-throughput screening methods to identify novel substrates or inhibitors of HI_1315?

Developing high-throughput screening (HTS) methods for HI_1315 requires optimized methodologies:

  • Assay Development and Optimization:

    • Transport Activity Assays: Design fluorescent or radioactive substrate analogs

    • Competition Assays: Measure displacement of known substrate by test compounds

    • Conformational Change Detection: Develop FRET-based sensors for transport-associated movements

    • Growth-Based Screens: Engineer strains requiring HI_1315 function for growth

  • Assay Validation and Quality Control:

ParameterTarget ValueOptimization Approach
Z'-factor>0.5Optimize signal-to-background ratio and reduce variability
Signal window>2-foldEnhance detection sensitivity and reduce background
Coefficient of variation<15%Standardize protocols and reduce technical variables
DMSO tolerance≥1%Test tolerance limits and establish working concentrations
Miniaturization capability384 or 1536-wellAdapt protocols for higher density formats
  • Compound Library Selection:

    • Chemical Diversity: Ensure broad structural coverage of chemical space

    • Natural Product Libraries: Include microbial and plant extracts

    • Fragment Libraries: Screen smaller chemical building blocks

    • Focused Libraries: Target compounds likely to interact with transporters

    • Repurposing Libraries: Test approved drugs for new activities

  • Advanced Screening Approaches:

    • Multiplexed Screening: Test multiple parameters in a single assay

    • Quantitative High-Throughput Screening (qHTS): Screen compounds at multiple concentrations

    • Phenotypic Screening: Identify compounds affecting HI_1315-dependent phenotypes

    • Targeted Deconvolution: Identify active components in complex mixtures

  • Hit Validation and Characterization Strategy:

    • Dose-Response Confirmation: Test hits in 8-12 point concentration series

    • Orthogonal Assays: Validate hits using alternative detection methods

    • Counter-Screening: Eliminate false positives and non-specific compounds

    • Mechanism of Action Studies: Determine how hits affect HI_1315 function

  • Experimental Design Considerations:

    • Plate Layout Optimization: Distribute controls to detect position effects

    • Randomization: Randomize compound locations to prevent bias

    • Replication Strategy: Determine optimal number of replicates

    • Quality Control Metrics: Implement real-time monitoring of assay performance

By developing and implementing this comprehensive high-throughput screening framework, researchers can efficiently identify novel substrates and inhibitors of HI_1315, accelerating the understanding of its biological function and potential therapeutic targeting .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.