Recombinant Haemophilus influenzae Putative uncharacterized transporter HI_0586 (HI_0586)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant protein is generated under optimized conditions to ensure stability and functionality:

  • Expression System: E. coli

  • Tag: N-terminal His tag for affinity chromatography

  • Form: Lyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

  • Reconstitution: Recommended in deionized water (0.1–1.0 mg/mL) with 50% glycerol for long-term storage at -80°C

Functional Insights

While HI_0586’s specific role remains unconfirmed, comparative studies on Haemophilus influenzae transporters provide context:

  • Family Classification: Belongs to the DcuC/DcuD family, which typically transports C4-dicarboxylates (e.g., fumarate, succinate) in bacteria .

  • Homology: Shares sequence similarity with transporters involved in ion/substrate symport or antiport .

  • Putative Role: Hypothesized to contribute to nutrient uptake or stress response, akin to other H. influenzae transporters like the TRAP-family sialic acid transporter (HI0147) or MFS-family multidrug efflux pumps .

Research Applications

HI_0586 is primarily used in biochemical and structural studies:

  • SDS-PAGE Analysis: Serves as a control or reference for membrane protein electrophoresis .

  • Antigen Production: Potential use in antibody generation for pathogenicity studies .

  • Functional Assays: Preliminary investigations into substrate specificity or ion transport mechanisms .

Comparative Analysis with Related Transporters

TransporterFamilyFunctionReference
HI_0586DcuC/DcuDPutative substrate/ion transport
SiaT (HI0147)TRAPSialic acid uptake
MdrPMFSNa+/H+ antiport, multidrug efflux

Challenges and Future Directions

  • Functional Characterization: No direct substrate or ion transport data exists for HI_0586. Structural studies (e.g., cryo-EM) or knockout assays are needed to elucidate its role.

  • Pathogenic Relevance: Transporters in H. influenzae are critical for virulence and survival in host environments . HI_0586’s contribution to pathogenicity remains unexplored.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
HI_0586; Putative uncharacterized transporter HI_0586
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-145
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
HI_0586
Target Protein Sequence
MELFKSIVAVIGIIATIYFLIKKAETRTVLIGVGLIMSILTLNPMGALDAFAKSMTSGGL IMAICSSMGFAYVMKYTQCDTHLVHLLTKPLSGLKFFLIPIATIITFFINIAIPSAAGCA AAVGATLIPVLKSAGVRPATAGQLF
Uniprot No.

Target Background

Database Links

STRING: 71421.HI0586

Protein Families
DcuC/DcuD transporter (TC 2.A.61) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Haemophilus influenzae Putative uncharacterized transporter HI_0586?

Haemophilus influenzae Putative uncharacterized transporter HI_0586 (UniProt ID: P44019) is a transmembrane protein from Haemophilus influenzae strain ATCC 51907/DSM 11121/KW20/Rd. The protein consists of 145 amino acids and, as the name suggests, is predicted to function as a membrane transporter, though its specific substrates and exact transport mechanism remain largely uncharacterized . The protein likely plays a role in nutrient acquisition or waste product elimination, consistent with the general functions of bacterial membrane transporters. The "putative" designation indicates that its function has been predicted based on sequence homology or structural features rather than direct experimental evidence.

How should recombinant HI_0586 be handled and stored for optimal stability?

For optimal stability, recombinant HI_0586 should be stored at -20°C for regular use, and at -20°C to -80°C for extended storage . To minimize protein degradation, repeated freeze-thaw cycles should be avoided. For working solutions, it is recommended to prepare aliquots and store them at 4°C for up to one week .

The protein's shelf life varies depending on storage conditions:

  • Liquid form: approximately 6 months when stored at -20°C/-80°C

  • Lyophilized form: approximately 12 months when stored at -20°C/-80°C

For reconstitution of lyophilized protein, it is recommended to:

  • Briefly centrifuge the vial before opening

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (typically 50%)

  • Prepare aliquots for long-term storage at -20°C/-80°C

What expression systems are optimal for producing functional HI_0586?

Recombinant HI_0586 is typically expressed in E. coli expression systems . The protein's relatively small size (145 amino acids) makes it amenable to prokaryotic expression, and E. coli provides a cost-effective and scalable platform. For the recombinant protein described in the literature, an in vitro E. coli expression system was used to produce the full-length protein (amino acids 1-145) .

When designing an expression strategy, consider the following methodological approaches:

Expression SystemAdvantagesConsiderations
E. coli (standard)Cost-effective, high yield, well-established protocolsMay not incorporate post-translational modifications
E. coli strains for membrane proteins (e.g., C41, C43)Optimized for membrane protein expressionMay require optimization of induction conditions
Cell-free expressionAvoids toxicity issues, rapid productionHigher cost, potentially lower yield
Yeast systemsBetter for eukaryotic proteins, some post-translational modificationsLonger expression time, more complex protocols

For optimal expression:

  • Select an appropriate E. coli strain optimized for membrane protein expression

  • Use a vector with an inducible promoter (e.g., T7)

  • Include a suitable tag (commonly N-terminal His-tag) for purification

  • Optimize induction conditions (temperature, inducer concentration, duration)

  • Consider using specialized media with osmolytes or mild detergents to stabilize the protein during expression

How can I assess the structure-function relationship of HI_0586?

Investigating the structure-function relationship of HI_0586 requires a multi-faceted approach combining computational predictions and experimental validation:

  • Computational structure prediction:

    • Use homology modeling based on related transporters

    • Apply transmembrane topology prediction algorithms

    • Utilize molecular dynamics simulations to predict conformational changes

  • Experimental structure determination:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy

    • NMR spectroscopy for specific domains

  • Functional assessment:

    • Transport assays using reconstituted proteoliposomes

    • Whole-cell transport assays with radioactive or fluorescent substrates

    • Binding assays to identify potential substrates

  • Structure-function correlation:

    • Site-directed mutagenesis of predicted key residues

    • Crosslinking studies to identify conformational changes

    • Accessibility studies using cysteine-scanning mutagenesis

Since HI_0586 is uncharacterized, initial computational predictions can guide targeted experimental approaches to elucidate its function. Given its classification as a transmembrane protein, it likely contains multiple membrane-spanning domains that form a transport channel or pore .

What kinetic parameters should be considered when analyzing HI_0586 transport function?

When analyzing membrane transporters like HI_0586, several key kinetic parameters should be examined:

ParameterDescriptionTypical UnitsMeasurement Method
V₁₈ₓMaximum transport ratenmol/min/mgTransport assays with varying substrate concentrations
KₘSubstrate concentration at half-maximum rateμM or mMTransport assays with varying substrate concentrations
K₁Inhibition constantμM or mMTransport assays with varying inhibitor concentrations
P₅₁₆Passive diffusion coefficientcm/sMeasured in control cells or artificial membranes
Temperature dependenceEffect of temperature on transport rates-Transport assays at different temperatures

For accurate estimation of these parameters, it's crucial to distinguish between active transport, passive diffusion, and non-specific binding . Research has shown that conventional kinetic analysis methods can lead to high coefficients of variation (CVs) for V₁₈ₓ and Kₘ (58% and 115%, respectively), while mechanistic modeling approaches significantly improve precision (reducing CVs to 19% and 23%) .

Temperature has been shown to significantly affect permeability measurements, with some compounds showing 1.5-16-fold higher passive permeability at 37°C compared to 4°C . Therefore, it's recommended to evaluate P₅₁₆ under the same experimental conditions as V₁₈ₓ and Kₘ (i.e., at 37°C) rather than performing control evaluations at 4°C .

How can I design a comprehensive mechanistic model for analyzing HI_0586 transport kinetics?

Developing a mechanistic model for HI_0586 transport requires accounting for active transport, passive diffusion, and non-specific binding. Based on established research methodologies, a two-compartmental model is recommended :

  • Model components to incorporate:

    • Bidirectional passive diffusion

    • Active uptake processes

    • Non-specific binding

    • Physiological cell parameters

  • Step-by-step approach:
    a. Collect time-course transport data at multiple substrate concentrations
    b. Measure passive permeability coefficient (P₅₁₆) under identical conditions
    c. Quantify non-specific binding to experimental apparatus
    d. Develop differential equations representing:

    • Rate of change in extracellular compartment

    • Rate of change in cellular compartment

    • Binding equilibria
      e. Use numerical methods to solve the system of equations
      f. Fit experimental data to derive transport parameters

  • Example model formulation:

    dCoutdt=Pdiff×A×(CoutCin)Vmax×CoutKm+Cout\frac{dC_{out}}{dt} = -P_{diff} \times A \times (C_{out} - C_{in}) - \frac{V_{max} \times C_{out}}{K_m + C_{out}}

    dCindt=Pdiff×A×(CoutCin)+Vmax×CoutKm+Cout\frac{dC_{in}}{dt} = P_{diff} \times A \times (C_{out} - C_{in}) + \frac{V_{max} \times C_{out}}{K_m + C_{out}}

    Where:

    • C₁₁₁ is the extracellular concentration

    • C₁₆ is the intracellular concentration

    • A is the cell surface area

    • P₅₁₆₆ is the passive diffusion coefficient

    • V₁₈ₓ is the maximum transport rate

    • Kₘ is the Michaelis-Menten constant

Research has demonstrated that this mechanistic modeling approach significantly improves parameter estimation accuracy compared to conventional methods, with CVs for V₁₈ₓ and Kₘ reduced from 58% and 115% to 19% and 23%, respectively .

What experimental design considerations are critical for characterizing temperature-dependent transport properties of HI_0586?

Temperature significantly impacts both active transport and passive permeability of membrane proteins. A comprehensive experimental design should account for these effects when characterizing HI_0586:

  • Temperature range selection:

    • Physiological temperature (37°C) is essential

    • Include lower temperatures (e.g., 4°C, 25°C) to establish temperature dependence

    • Consider testing at elevated temperatures to assess thermal stability

  • Critical experimental controls:

    • Measure passive diffusion at each temperature point

    • Include non-transfected cells or empty vector controls

    • Incorporate known substrates with established temperature profiles

  • Data analysis framework:

    • Apply Arrhenius plots to determine activation energy:
      ln(k)=ln(A)EaRT\ln(k) = \ln(A) - \frac{E_a}{RT}

    • Calculate temperature coefficients (Q₁₀) to quantify temperature sensitivity:
      Q10=(k2k1)10T2T1Q_{10} = \left(\frac{k_2}{k_1}\right)^{\frac{10}{T_2-T_1}}

    • Use mechanistic models that incorporate temperature-dependent parameters

  • Methodological considerations:

    • Maintain precise temperature control throughout experiments

    • Allow sufficient equilibration time at each temperature

    • Account for temperature effects on pH of buffers

    • Consider temperature impacts on membrane fluidity

Research has shown that permeability measurements can vary dramatically with temperature, with some compounds showing 1.5-16-fold higher passive permeability at 37°C compared to 4°C . This highlights the importance of measuring P₥₁₆ under the same experimental conditions as V₁₈ₓ and Kₘ, rather than performing control evaluations at different temperatures .

How can I integrate data analytics approaches to resolve contradictory experimental results for HI_0586?

This integrative approach aligns with established data analysis workflows that emphasize defining questions, collecting and cleaning data, performing analysis, and sharing results in a cyclical process of refinement .

The key distinction between research and analysis is important here: while research focuses on gathering information, analysis involves evaluating and interpreting that information to make informed decisions . For contradictory HI_0586 results, both aspects are crucial for resolving discrepancies.

What are the optimal approaches for predicting potential substrates of uncharacterized transporters like HI_0586?

Predicting substrates for uncharacterized transporters like HI_0586 requires a multi-faceted approach combining computational predictions with targeted experimental validation:

  • Computational prediction methods:

    • Sequence-based approaches:

      • Phylogenetic analysis to identify closest characterized homologs

      • Motif identification for substrate binding sites

      • Machine learning models trained on known transporter-substrate pairs

    • Structure-based approaches:

      • Homology modeling of the transporter structure

      • Molecular docking of potential substrates

      • Molecular dynamics simulations to assess binding stability

    • Systems biology approaches:

      • Metabolic network analysis to identify likely transported metabolites

      • Gene neighborhood analysis to infer function from genomic context

      • Co-expression analysis to identify functionally related proteins

  • Experimental validation strategies:

    • High-throughput screening:

      • Transport assays with libraries of potential substrates

      • Growth complementation in auxotrophic strains

      • Metabolomic profiling of cells with/without the transporter

    • Targeted validation:

      • Radioactive or fluorescent substrate uptake assays

      • Electrophysiological measurements (if ion transport is suspected)

      • Binding assays with predicted substrates

    • In vivo approaches:

      • Gene knockout studies to identify phenotypes

      • Overexpression studies to identify metabolic impacts

      • Reporter gene assays for transport-dependent regulation

  • Integration and refinement:

    • Prioritize substrate candidates based on computational predictions

    • Validate top candidates experimentally

    • Refine computational models with experimental data

    • Iterate to expand substrate range characterization

This comprehensive approach leverages both predictive algorithms and empirical testing to systematically narrow down potential substrates for HI_0586, ultimately leading to functional characterization of this uncharacterized transporter.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.