Recombinant Haemophilus influenzae Putative zinc metalloprotease HI_0918 (HI_0918)

Shipped with Ice Packs
In Stock

Description

Introduction

Haemophilus influenzae is a Gram-negative bacterium known to cause respiratory infections . Among its various proteins, the putative zinc metalloprotease HI_0918 is believed to play a role in bacterial physiology. Metalloproteases, in general, are enzymes that require metal ions, such as zinc, for their activity .

Zinc Metalloproteases in Haemophilus influenzae

Zinc metalloproteases are a family of enzymes that utilize zinc ions for catalytic activity . These proteases are involved in various biological processes, including virulence and nutrient acquisition . In Haemophilus influenzae, zinc-dependent mechanisms are crucial for survival and pathogenesis, particularly in environments where zinc availability is limited .

HI_0918 and Zinc Uptake

The protein PZP1, gene product of HI0119, is a periplasmic zinc-binding protein in H. influenzae . A mutant deficient in pzp1 shows impaired growth under aerobic and anaerobic conditions, which can be rescued by adding high concentrations of zinc . Recombinant PZP1 can bind approximately two zinc atoms per protein molecule, and up to five zinc atoms after EDTA incubation and further zinc addition .

ZevAB: A Novel Zinc-Binding System

The "zinc binding essential for virulence" (zev) locus, consisting of zevA (HI1249) and zevB (HI1248), is a novel virulence factor important for zinc utilization of H. influenzae under zinc-limiting conditions . Mutants of zevA and zevB exhibit growth defects in medium containing EDTA, which can be rescued by zinc supplementation . ZevA binds to zinc with high affinity, suggesting that zinc limitation is an important mechanism for host defense during lung infection .

Role in Virulence

Metalloproteases like HI_0918 are often associated with the virulence of bacterial pathogens . They can degrade host tissues, interfere with immune responses, or facilitate nutrient acquisition . For instance, the zinc metalloproteases IgA1 protease, ZmpB, ZmpC, and ZmpD are crucial for the virulence of Streptococcus pneumoniae .

Relevance to Iron/Heme Acquisition

Haemophilus influenzae requires heme for aerobic growth and has multiple mechanisms to obtain this nutrient . Iron and heme availability can alter the transcription of certain genes, but the specific role of HI_0918 in iron/heme acquisition is not well-defined .

Nitroreductase Activity

Haemophilus influenzae nitroreductase (HiNfsB) is involved in metabolizing nitroheterocyclic antibiotics . Although HI_0918 is not directly linked to nitroreductase activity, understanding other enzymatic functions in H. influenzae provides a broader context for its metabolic capabilities .

Recombinant Production

Recombinant Haemophilus influenzae proteins, such as IgA1 protease, can be produced in E. coli strains . This method allows for the production of soluble and active proteins, which can be used for further biochemical and structural characterization .

Purine Synthesis Pathway

The purine synthesis pathway in Haemophilus influenzae benefits its infectivity within the airways . While HI_0918 is not directly involved in purine synthesis, understanding metabolic pathways that contribute to the bacterium's survival can offer insights into the broader context of its virulence mechanisms .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rsep; HI_0918; Regulator of sigma E protease; S2P endopeptidase; Site-2 protease RseP; S2P protease RseP; Site-2-type intramembrane protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-443
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
rsep
Target Protein Sequence
MSFLWSLGSFIIAIAVLVSVHEYGHFWAARKCGIKVHRFSIGFGKVIWKRIDKYGTEFAV SMIPLGGYVKMLDGRNEVVPAEQKSQAFDSKSVLQRSFVIIAGPLANFIFAIFAYWVIYL YGMPTVKPVIESITPNSIAAQAHIEPNTQILTIDGEETQDWETINMLLATKMGEPNVEIS LSPFNSNIEQQRTLNLTNWTFDPEKESAFEALGIMPMRPKIEMVLSKVVQNSPAEKAGLQ IGDKILKENLTALPWQDFIKQVEQGESFSIKVERNGETFDKVLTPVRNQNGKWFVGVSPA LTKLADEYRTELKYGILESLQKGIEKTGQLSLLTLKILGKLLTGDLSLNNLSGPISIAKG AGASANIGLVYFLSFMALISVNLGIMNLFPLPVLDGGHLVFLTMEAVKGKPVSERVQSIC YRIGAALLLSLTVFALFNDFLRL
Uniprot No.

Target Background

Function
Recombinant *Haemophilus influenzae* Putative zinc metalloprotease HI_0918 (HI_0918) is a site-2 regulated intramembrane protease (S2P) that cleaves a peptide bond within the transmembrane region of RseA. It is a component of the regulated intramembrane proteolysis (RIP) cascade. HI_0918 acts on DegS-cleaved RseA, releasing the cytoplasmic domain of RseA. This proteolytic event ultimately activates sigma-E (RpoE) factor in the cell.
Database Links

KEGG: hin:HI0918

STRING: 71421.HI0918

Protein Families
Peptidase M50B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Haemophilus influenzae Putative zinc metalloprotease HI_0918 and why is it significant for research?

Haemophilus influenzae Putative zinc metalloprotease HI_0918 is a specific zinc-dependent enzyme found in the pathogenic bacterium H. influenzae, a Gram-negative coccobacillary facultatively anaerobic organism responsible for a wide range of localized and invasive infections . This metalloprotease belongs to the M48 family of zinc-dependent proteases, which contain the conserved HExxH motif in their active site that coordinates zinc binding .

The significance of HI_0918 stems from H. influenzae's role as a major opportunistic human pathogen that causes both non-invasive and invasive disease . While the Hib vaccine has reduced invasive disease, non-typeable H. influenzae remains a public health burden worldwide with increasing reports of multi-drug resistance . Metalloproteases like HI_0918 may play crucial roles in bacterial pathogenesis, making them important targets for research into bacterial virulence mechanisms.

What experimental techniques are commonly used to express and purify recombinant HI_0918?

Expression and purification of recombinant HI_0918 typically involve several key methodological approaches:

Expression Systems:

  • E. coli expression systems using T7-inducible promoters, with IPTG induction for controlled expression

  • Alternative systems include yeast, baculovirus, or mammalian cell expression systems for more complex processing requirements

Purification Strategy:

  • Subcellular fractionation to localize the protein (periplasmic, cytoplasmic, or membrane-associated)

  • Immobilized metal affinity chromatography (IMAC) using histidine tags for initial capture

  • Gel filtration chromatography for further purification and determination of molecular weight

Signal Sequence Modification:
For membrane-associated metalloproteases, researchers often employ recombinant DNA technology to replace N-terminal lipid modification signal sequences with ones for protein secretion, facilitating easier extraction and purification .

Assessment Methods:

  • SDS-PAGE for molecular weight verification

  • Western blotting for identity confirmation

  • Activity assays for functional validation

This approach has been successfully applied to other H. influenzae proteins, such as the bacterial lipoprotein e (P4), resulting in high levels of enzymatic activity while maintaining properties similar to the wild-type protein .

How can researchers verify the zinc-binding properties of recombinant HI_0918?

Verification of zinc-binding properties requires multiple complementary approaches:

Spectroscopic Methods:

  • Atomic absorption spectroscopy to quantify zinc atoms per protein molecule

  • Neutron activation analysis as an alternative quantification method

Metal-Binding Confirmation:

  • Incubation with chelating agents (e.g., EDTA) to remove bound zinc

  • Reconstitution experiments by adding zinc back to the apo-enzyme

  • Activity recovery measurements following zinc reintroduction

Radioisotope Approaches:

  • Direct binding of 65Zn to recombinant protein followed by Western blot analysis

Structural Analysis:

  • X-ray crystallography to visualize zinc coordination sites

  • Mutagenesis of coordinating residues (typically histidines and glutamates in the HExxH motif) followed by functional assessment

For example, in studies of the periplasmic zinc-binding protein PZP1 in H. influenzae, researchers determined that recombinant PZP1 contained approximately two zinc atoms per protein molecule using neutron activation analysis and atomic absorption spectroscopy. They further demonstrated that zinc could be removed by EDTA treatment and that additional zinc atoms (up to five per protein) could be bound upon further zinc addition .

What methods are available for analyzing the enzymatic activity of HI_0918?

Analysis of HI_0918 enzymatic activity involves several approaches tailored to metalloprotease characteristics:

Substrate Identification:

  • Incubation with known metalloprotease substrates followed by SDS-PAGE to detect cleavage products

  • Mass spectrometry to identify cleavage sites and characterize fragments

Quantitative Activity Assays:

  • Spectrophotometric assays using synthetic chromogenic or fluorogenic peptide substrates

  • FRET-based assays for real-time monitoring of proteolytic activity

Inhibition Studies:

  • Testing with known metalloprotease inhibitors (e.g., EDTA, 1,10-phenanthroline)

  • Dose-response curves to determine IC50 values

  • Analysis of active site interactions using structure-guided mutants

Activity Characterization Parameters:

  • pH optimum determination

  • Temperature stability assessment

  • Metal ion dependency (zinc specificity vs. other divalent metals)

  • Substrate specificity profiling

These methods can be applied in a manner similar to the characterization of other H. influenzae metalloproteases, such as the phosphomonoesterase lipoprotein e (P4), where researchers determined substrate specificity, pH optimum, and inhibitor sensitivity profiles .

What structural features are characteristic of zinc metalloproteases like HI_0918, and how do they inform function?

Zinc metalloproteases like HI_0918 share several key structural elements that directly relate to their function:

Conserved Catalytic Domain:

  • HExxH motif: Contains two histidine residues that coordinate the active-site zinc and a catalytic glutamate residue that activates a zinc-bound water molecule for nucleophilic attack on the substrate peptide bond

  • Additional zinc-coordinating residue often found 18-45 residues C-terminal to the HExxH motif

Active Site Architecture:

  • An active site cleft bifurcated by an N-terminal subdomain (NSD) and a C-terminal subdomain (CSD)

  • Active site accessibility potentially regulated by an active site "plug" element, as seen in the M48 metalloprotease family

  • Three C-terminal strands of a β-sheet in the NSD often form a ψ-loop motif

Substrate Recognition Elements:

  • Specific substrate recognition pockets that determine cleavage site specificity

  • Electrostatic interactions between charged residues in the protease and substrate

Domain Organization:

  • Many zinc metalloproteases contain additional domains (e.g., TPR domains) that mediate protein-protein interactions or substrate recognition

  • These domains can form a "nautilus-like structure" with the metalloprotease domain, as observed in the BepA M48-metalloprotease

Understanding these structural features is essential for predicting substrate specificity and for developing inhibitors that target HI_0918.

How does HI_0918 compare to other zinc metalloproteases in H. influenzae and related bacteria?

Comparing HI_0918 to other zinc metalloproteases provides important contextual understanding:

Within H. influenzae:

  • Periplasmic Zinc-binding Protein (PZP1): Product of gene HI0119, functions in zinc uptake rather than proteolysis; critical for growth under aerobic conditions

  • Lipoprotein e (P4): Surface-localized phosphomonoesterase with distinct substrate specificity from typical metalloproteases

Comparison with Other Bacterial Metalloproteases:

MetalloproteaseOrganismFunctionStructural FeaturesReference
HI_0918H. influenzaePutative zinc metalloproteaseHExxH motif
BepAE. coliM48-metalloproteaseTPR domain, active site plug
GtgA/GogA/PipASalmonella entericaCleaves NF-κB subunitsHExxH motif
NleC/NleDE. coli (EPEC/EHEC)Cleaves NF-κB/MAP kinasesHExxH motif
ZMPSTE24HumanCleaves prelamin ASeven-transmembrane scaffold

Evolutionary Relationships:

  • Despite low sequence identity, many bacterial zinc metalloproteases maintain the structural topology of the Zincin superfamily

  • Conservation of the active site plug element (H-P-x(4)-R motif) across the M48 metalloprotease family suggests functional importance

This comparative analysis helps researchers predict potential functions and mechanisms of HI_0918 based on better-characterized homologs.

What experimental approaches can be used to study the role of HI_0918 in H. influenzae pathogenesis?

Investigating HI_0918's role in pathogenesis requires multiple complementary approaches:

Genetic Manipulation:

  • Construction of gene deletion mutants using techniques like natural transformation

  • Complementation studies with wild-type and mutant versions of HI_0918

  • Allelic replacement experiments to study variant effects

Transformed Recombinant Enrichment Profiling (TREP):
This innovative approach involves:

  • Generating complex pools of recombinants through natural transformation

  • Applying phenotypic selection to enrich for specific recombinants

  • Using deep sequencing to identify genetic variations responsible for phenotypic changes

High-throughput Insertion Tracking by Deep Sequencing (HITS):

  • Creates a whole-genome transposon mutant bank

  • Combines with deep sequencing to analyze genes essential for bacterial pathogenesis

  • Employs negative selection to identify genes required for growth/survival under specific conditions

In vitro Infection Models:

  • Adhesion and invasion assays using relevant cell lines (e.g., airway epithelial cells)

  • Bacterial self-aggregation assessments

  • Immunofluorescence microscopy to visualize bacterial localization

In vivo Models:

  • Mouse models of pulmonary infection to assess bacterial survival and clearance

  • Competitive index assays comparing wild-type and HI_0918 mutants

  • Analysis of host immune responses to infection

These approaches have been successfully applied to identify other H. influenzae virulence factors, such as HMW1 adhesin in intracellular invasion .

How can researchers distinguish between direct and indirect effects of HI_0918 on bacterial phenotypes?

Distinguishing direct from indirect effects requires systematic experimental approaches:

Domain and Motif Analysis:

  • Identification of conserved catalytic motifs (HExxH) and comparison with known metalloproteases

  • Site-directed mutagenesis of key catalytic residues to generate proteolytically inactive variants

  • Complementation with active vs. inactive variants to assess phenotype rescue

Biochemical Substrate Identification:

  • In vitro cleavage assays with purified recombinant HI_0918 and potential substrates

  • Identification of cleavage products by mass spectrometry

  • Verification of cleavage sites through N-terminal sequencing of fragments

Temporal Analysis:

  • Time-course experiments to establish the sequence of events following HI_0918 expression or deletion

  • Correlation analysis between protease activity and phenotypic outcomes

  • Conditional expression systems to control the timing of HI_0918 activity

Multi-phenotype Assessment:

PhenotypeDirect Effect IndicatorIndirect Effect Indicator
Bacterial adhesionCleavage of host receptorsAltered expression of other adhesins
InvasionDegradation of host barriersIncreased adherence leading to invasion
Immune evasionCleavage of immune effectorsAltered surface antigen presentation
Nutrient acquisitionMetal ion binding/transportChanged metabolic pathways

Controlled Environment Studies:

  • Varying experimental conditions (pH, temperature, zinc availability) to isolate specific effects

  • Using defined media to control for nutrient-related indirect effects

This methodical approach helps researchers avoid misattributing phenotypes to direct HI_0918 activity when they may be downstream consequences.

What experimental design considerations are critical when studying HI_0918 interactions with host factors?

Designing experiments to study HI_0918-host interactions requires careful attention to several factors:

Selection of Appropriate Control Strains:

  • Isogenic mutants differing only in HI_0918 expression/activity

  • Complemented strains to verify phenotype restoration

  • Catalytically inactive HI_0918 mutants (e.g., HExxH → HAxxH) to distinguish proteolytic from non-proteolytic functions

Host Cell Model Considerations:

  • Primary vs. immortalized cell lines (impact on physiological relevance)

  • Species-specific differences in host targets

  • Polarized vs. non-polarized epithelial cells (apical/basolateral access)

Experimental Variables Control:

VariableControl MethodRationale
Bacterial growth phaseStandardize culture conditionsGene expression varies with growth phase
MOI (multiplicity of infection)Optimize and standardize across experimentsAffects host cell responses
Infection durationTime-course experimentsCaptures both early and late events
Oxygen levelsControl atmospheric conditionsH. influenzae adapts to aerobic/anaerobic environments
Zinc availabilityDefined media with/without zinc supplementationMay affect HI_0918 activity and expression

Detection Methods Optimization:

  • Fluorescence labeling of bacteria and host structures

  • Live-cell imaging vs. fixed-cell approaches

  • Super-resolution microscopy for detailed localization studies

Multi-parameter Analysis:

  • Combining proteomics, transcriptomics, and functional assays

  • Correlating HI_0918 activity with changes in host cell signaling

  • Systems biology approaches to model interaction networks

These considerations help ensure reproducible, physiologically relevant data that accurately reflect HI_0918's role in host-pathogen interactions.

How can researchers address contradictory findings regarding HI_0918 function in different experimental systems?

Resolving contradictory findings requires systematic investigation of potential sources of variability:

Strain-Specific Variation Analysis:

  • Sequencing and comparing HI_0918 across different H. influenzae strains

  • Whole-genome sequencing to identify genetic backgrounds that might influence HI_0918 function

  • Cross-complementation experiments between strains

Methodological Reconciliation Framework:

  • Standardize Experimental Conditions:

    • Define precise growth media composition

    • Control environmental parameters (temperature, pH, oxygen levels)

    • Establish consistent protein purification protocols

  • Compare Experimental Systems Directly:

    • Side-by-side testing of different systems using identical reagents

    • Identification of system-specific variables that might explain discrepancies

    • Development of conversion factors between different assay systems

  • Isolate Variables Sequentially:

    • Systematic variation of single parameters while holding others constant

    • Statistical analysis to identify significant influencing factors

    • Meta-analysis of published data to identify patterns in contradictions

Technical Sources of Variability:

SourceAssessment MethodMitigation Strategy
Protein tagsCompare tagged vs. untagged versionsUse cleavable tags or tag-free purification
Expression levelsQuantitative Western blottingTitrate expression to physiological levels
Post-translational modificationsMass spectrometry analysisCompare proteins from different expression systems
Zinc occupancyMetal content analysisStandardize zinc reconstitution procedures

Collaborative Resolution Approaches:

  • Multi-laboratory validation studies

  • Sharing of reagents and protocols between groups

  • Development of consensus standard operating procedures

By systematically addressing these factors, researchers can determine whether contradictory findings reflect true biological complexity or technical artifacts.

What advanced techniques can be applied to study the structural dynamics of HI_0918 during substrate binding and catalysis?

Understanding the structural dynamics of HI_0918 requires sophisticated biophysical approaches:

Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

  • Maps solvent accessibility changes upon substrate binding

  • Identifies regions with altered conformational dynamics

  • Provides insights into allosteric effects and conformational changes

Single-Molecule FRET (smFRET):

  • Monitors distance changes between strategically placed fluorophores

  • Reveals conformational states and their transitions in real-time

  • Detects rare or transient conformational intermediates

Molecular Dynamics Simulations:

  • All-atom simulations of HI_0918 with and without bound substrate

  • Analysis of active site water dynamics and proton transfer events

  • Identification of conformational changes associated with catalysis

  • Investigation of the role of the active site plug in substrate access

Cryo-Electron Microscopy:

  • Visualization of HI_0918 in different conformational states

  • Structural characterization of enzyme-substrate complexes

  • Determination of oligomerization states relevant to function

Time-Resolved X-ray Crystallography:

  • Capturing structural intermediates during catalysis

  • Comparison with structures of related metalloproteases like ZMPSTE24

  • Analysis of active site rearrangements during substrate binding

NMR Spectroscopy:

  • Chemical shift perturbation analysis upon substrate binding

  • Relaxation dispersion experiments to detect millisecond dynamics

  • Characterization of metal-binding site geometry

These advanced techniques provide complementary insights into HI_0918 function at the atomic and molecular levels, revealing the dynamic processes underlying its catalytic mechanism.

How can genome-scale approaches be applied to understand the broader biological context of HI_0918 in H. influenzae?

Genome-scale approaches offer powerful tools for contextualizing HI_0918 function:

Transcriptomic Profiling:

  • RNA-seq of wild-type vs. HI_0918 mutant strains under various conditions

  • Identification of co-regulated genes and potential operons

  • Characterization of transcriptional responses to zinc limitation or host factors

Proteomics Approaches:

  • Global proteome changes in HI_0918 mutants

  • Identification of proteins with altered abundance or modification

  • Protein-protein interaction mapping using proximity labeling or co-immunoprecipitation

Comprehensive Transposon Mutagenesis:

  • HITS (High-throughput Insertion Tracking by Deep Sequencing) to identify genetic interactions

  • Synthetic lethal/sick screens with HI_0918 mutations

  • Identification of genes required for adaptation to specific environments

Transformed Recombinant Enrichment Profiling (TREP):

  • Using natural transformation to generate recombinant pools

  • Applying selection pressure relevant to HI_0918 function

  • Deep sequencing to identify adaptive genetic variants

Systems Biology Integration:

Data TypeAnalysis ApproachInsights Provided
GenomicPopulation genomics, evolutionary analysisConservation and selection pressure on HI_0918
TranscriptomicCo-expression network analysisFunctional associations and regulation
ProteomicInteraction networks, pathway analysisPhysical and functional protein relationships
PhenomicHigh-throughput phenotyping, multivariate analysisPhenotypic consequences of HI_0918 variation

Comparative Genomics:

  • Analysis of HI_0918 conservation across H. influenzae strains

  • Identification of lineage-specific adaptations

  • Correlation with strain pathogenicity and host range

These genome-scale approaches place HI_0918 in its broader biological context, revealing its relationships with other cellular processes and its role in bacterial adaptation and pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.